SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1mo9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mo9A
Domain Number 1 Region: 42-95,144-233,262-407
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000335
Further Details:      
 
Domain Number 2 Region: 385-506
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.15e-25
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mo9A   PDB: 1mo9
Sequence length 523
Comment (A:)
Sequence
MKVWNARNDHLTINQWATRIDEILEAPDGGEVIYNVDENDPREYDAIFIGGGAAGRFGSA
YLRAMGGRQLIVDRWPFLGGSCPHNACVPHHLFSDCAAELMLARTFSGQYWFPDMTEKVV
GIKEVVDLFRAGRNGPHGIMNFQSKEQLNLEYILNCPAKVIDNHTVEAAGKVFKAKNLIL
AVGAGPGTLDVPGVNAKGVFDHATLVEELDYEPGSTVVVVGGSKTAVEYGCFFNATGRRT
VMLVRTEPLKLIKDNETRAYVLDRMKEQGMEIISGSNVTRIEEDANGRVQAVVAMTPNGE
MRIETDFVFLGLGEQPRSAELAKILGLDLGPKGEVLVNEYLQTSVPNVYAVGDLIGGPME
MFKARKSGCYAARNVMGEKISYTPKNYPDFLHTHYEVSFLGMGEEEARAAGHEIVTIKMP
PDTENGLNVALPASDRTMLYAFGKGTAHMSGFQKIVIDAKTRKVLGAHHVGYGAKDAFQY
LNVLIKQGLTVDELGDMDELFLNPTHFIQLSRLRAGSKNLVSL
Download sequence
Identical sequences Q56839
WP_011992982.1.63109 gi|154243741|ref|YP_001409314.1|NC_009717 1mo9A 1mo9_A 1mo9_B 1mok_A 1mok_B 1mok_C 1mok_D 2c3c_A 2c3c_B 2c3d_A 2c3d_B 3q6j_A 3q6j_B 78245.Xaut_4867 gi|154243741|ref|YP_001409314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]