SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1muaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1muaA
Domain Number 1 Region: 2-256
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.53e-143
Family Carbonic anhydrase 0.0000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1muaA   PDB: 1mua   SUPERFAMILY: 1muaA
Sequence length 256
Comment (A:)
Sequence
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttpallecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasf
Download sequence
Identical sequences 000044424|e1muaA1|62.1.1.1|A:1-256 cath|current|1muaA00/4-260 d1muaa_ 1mua_A 1muaA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]