SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1mx3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mx3A
Domain Number 1 Region: 22-138
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.9e-63
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 122-312
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.03e-56
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mx3A   PDB: 1mx3
Sequence length 347
Comment (A:)
Sequence
mgsshhhhhhssglvprgshmplvalldgrdctvempilkdvatvafcdaqstqeihekv
lneavgalmyhtitltredlekfkalriivrigsgfdnidiksagdlgiavcnvpaasve
etadstlchilnlyrratwlhqalregtrvqsveqirevasgaarirgetlgiiglgrvg
qavalrakafgfnvlfydpylsdgveralglqrvstlqdllfhsdcvtlhcglnehnhhl
indftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplkd
apnlictphaawyseqasiemreeaareirraitgripdslkncvnk
Download sequence
Identical sequences 1mx3A 1mx3_A 4lce_A 4u6q_A 4u6s_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]