SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1naaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1naaA
Domain Number 1 Region: 2-282,475-536
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.21e-55
Family FAD-linked reductases, N-terminal domain 0.000000000104
Further Details:      
 
Domain Number 2 Region: 299-479
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.78e-55
Family GMC oxidoreductases 0.00000000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1naaA   PDB: 1naa
Sequence length 541
Comment (A:)
Sequence
tpydyiivgagpggiiaadrlseagkkvlllerggpstkqtggtyvapwatssgltkfdi
pglfeslftdsnpfwwckditvfagclvgggtsvngalywypndgdfsssvgwpsswtnh
apytsklssrlpstdhpstdgqryleqsfnvvsqllkgqgynqatindnpnykdhvfgys
afdflngkragpvatylqtalarpnftfktnvmvsnvvrngsqilgvqtndptlgpngfi
pvtpkgrvilsagafgtsrilfqsgigptdmiqtvqsnptaaaalppqnqwinlpvgmna
qdnpsinlvfthpsidayenwadvwsnprpadaaqylanqsgvfagaspklnfwraysgs
dgftryaqgtvrpgaasvnsslpynasqiftitvylstgiqsrgrigidaalrgtvltpp
wlvnpvdktvllqalhdvvsnigsipgltmitpdvtqtleeyvdaydpatmnsnhwvsst
tigsspqsavvdsnvkvfgtnnlfivdagiiphlptgnpqgtlmsaaeqaaakilalagg
p
Download sequence
Identical sequences 1naaA 1naa_A 1naa_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]