SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ndaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ndaA
Domain Number 1 Region: 1-103,231-352
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.7e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000026
Further Details:      
 
Domain Number 2 Region: 361-482
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.31e-34
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000398
Further Details:      
 
Domain Number 3 Region: 2-64,104-229
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.04e-16
Family N-terminal domain of adrenodoxin reductase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ndaA   PDB: 1nda
Sequence length 491
Comment (A:)
Sequence
mskifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpk
klmvtgaqymehlresagfgwefdrttlraewkkliavkdeavlninksyeemfrdtegl
efflgwgslesknvvnvresadpasavkerletenillasgswphmpnipgiehcissne
afylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltk
qltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnag
vmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgtnprktdhtr
vasavfsippigtcglieevaskryevvavylssftplmhnisgskyktfvakiitnhsd
gtvlgvhllgdnapeiiqgvgiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkg
ekmekpseasl
Download sequence
Identical sequences 1ndaA 1nda_A 1nda_B 1nda_C 1nda_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]