SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ng4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ng4A
Domain Number 1 Region: 25-240,327-385
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.65e-45
Family FAD-linked reductases, N-terminal domain 0.000000000523
Further Details:      
 
Domain Number 2 Region: 241-326
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.98e-20
Family D-aminoacid oxidase-like 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ng4A   PDB: 1ng4
Sequence length 390
Comment (A:)
Sequence
mghhhhhhhhhhssghiegrhmkrhyeavvigggiigsaiayylakenkntalfesgtmg
grttsaaagmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfkla
fseedvlqlrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvk
aakmlgaeifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaf
lpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvm
kkaktmlppiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatg
alisdlimnkevnqdwlhafridrkeavqi
Download sequence
Identical sequences 1ng4A 1ng3_A 1ng3_B 1ng4_A 1ng4_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]