SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1nh2D from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nh2D
Domain Number 1 Region: 54-118
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.46e-24
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 5-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 2.78e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nh2D   PDB: 1nh2
Sequence length 121
Comment (D:)
Sequence
avpgyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqsklt
vkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklrivacnskks
e
Download sequence
Identical sequences 1nh2D 1nh2_D 1ytf_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]