SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1nhpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nhpA
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.47e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000146
Further Details:      
 
Domain Number 2 Region: 322-445
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.71e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nhpA   PDB: 1nhp
Sequence length 447
Comment (A:)
Sequence
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflsagmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldi
pgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvidi
ldrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvvv
avgvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialat
narkqgrfavknleepvkpfpgvqgssglavfdykfastginevmaqklgketkavtvve
dylmdfnpdkqkawfklvydpettqilgaqlmskadltaninaislaiqakmtiedlaya
dfffqpafdkpwniintaaleavkqer
Download sequence
Identical sequences 1nhp_A 1nhpA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]