SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1nhqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nhqA
Domain Number 1 Region: 106-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.88e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000146
Further Details:      
 
Domain Number 2 Region: 322-445
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.71e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000295
Further Details:      
 
Domain Number 3 Region: 1-115
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.8e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nhqA   PDB: 1nhq
Sequence length 447
Comment (A:)
Sequence
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflssgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldi
pgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvidi
ldrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvvv
avgvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialat
narkqgrfavknleepvkpfpgvqgssglavfdykfastginevmaqklgketkavtvve
dylmdfnpdkqkawfklvydpettqilgaqlmskadltaninaislaiqakmtiedlaya
dfffqpafdkpwniintaaleavkqer
Download sequence
Identical sequences 1nhqA 1nhq_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]