SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1npxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1npxA
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000146
Further Details:      
 
Domain Number 2 Region: 322-445
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.71e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1npxA   PDB: 1npx
Sequence length 447
Comment (A:)
Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSCGMQLYLEGKVKDVNSVRY
MTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDI
PGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDI
LDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVV
AVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALAT
NARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVE
DYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYA
DFFFQPAFDKPWNIINTAALEAVKQER
Download sequence
Identical sequences A0A0H1TS15 A0A0M2ACP1 A0A0M2ASN0 A0A0M2CLC5 A0A0Y4EHC9 A0A0Y7FM36 A0A125W8A9 A0A1G1SEM7 A0A1R4L5Y1 C7D4B1 C7VBX6 E6GMQ6 S4F3I4 V7ZTI8
gi|397699591|ref|YP_006537379.1| 1npxA 1joa_A 1npx_A 2npx_A gi|384518310|ref|YP_005705615.1| WP_002357926.1.100415 WP_002357926.1.10042 WP_002357926.1.101808 WP_002357926.1.101914 WP_002357926.1.11048 WP_002357926.1.11284 WP_002357926.1.11459 WP_002357926.1.12145 WP_002357926.1.12235 WP_002357926.1.12247 WP_002357926.1.12449 WP_002357926.1.12625 WP_002357926.1.12630 WP_002357926.1.1291 WP_002357926.1.13021 WP_002357926.1.14485 WP_002357926.1.14750 WP_002357926.1.14792 WP_002357926.1.15224 WP_002357926.1.15458 WP_002357926.1.1595 WP_002357926.1.17164 WP_002357926.1.1799 WP_002357926.1.18259 WP_002357926.1.18390 WP_002357926.1.18416 WP_002357926.1.18475 WP_002357926.1.18709 WP_002357926.1.19031 WP_002357926.1.19165 WP_002357926.1.1948 WP_002357926.1.19601 WP_002357926.1.19734 WP_002357926.1.19951 WP_002357926.1.20029 WP_002357926.1.20348 WP_002357926.1.2067 WP_002357926.1.20674 WP_002357926.1.2171 WP_002357926.1.22059 WP_002357926.1.2207 WP_002357926.1.22780 WP_002357926.1.22796 WP_002357926.1.23319 WP_002357926.1.23322 WP_002357926.1.23498 WP_002357926.1.23904 WP_002357926.1.24023 WP_002357926.1.24059 WP_002357926.1.24581 WP_002357926.1.2486 WP_002357926.1.25583 WP_002357926.1.25669 WP_002357926.1.25702 WP_002357926.1.25979 WP_002357926.1.26451 WP_002357926.1.27081 WP_002357926.1.28038 WP_002357926.1.28221 WP_002357926.1.28817 WP_002357926.1.29097 WP_002357926.1.29985 WP_002357926.1.3016 WP_002357926.1.30275 WP_002357926.1.30609 WP_002357926.1.31224 WP_002357926.1.31326 WP_002357926.1.32500 WP_002357926.1.32914 WP_002357926.1.33139 WP_002357926.1.33513 WP_002357926.1.33581 WP_002357926.1.33685 WP_002357926.1.33798 WP_002357926.1.35171 WP_002357926.1.35283 WP_002357926.1.35449 WP_002357926.1.36198 WP_002357926.1.3645 WP_002357926.1.36880 WP_002357926.1.37031 WP_002357926.1.37810 WP_002357926.1.37850 WP_002357926.1.37885 WP_002357926.1.37996 WP_002357926.1.38784 WP_002357926.1.3909 WP_002357926.1.39771 WP_002357926.1.40357 WP_002357926.1.4071 WP_002357926.1.40757 WP_002357926.1.42239 WP_002357926.1.42353 WP_002357926.1.42904 WP_002357926.1.42908 WP_002357926.1.44501 WP_002357926.1.44537 WP_002357926.1.4487 WP_002357926.1.45484 WP_002357926.1.455 WP_002357926.1.4561 WP_002357926.1.45643 WP_002357926.1.45742 WP_002357926.1.46113 WP_002357926.1.46346 WP_002357926.1.46363 WP_002357926.1.46448 WP_002357926.1.46606 WP_002357926.1.46621 WP_002357926.1.47539 WP_002357926.1.48126 WP_002357926.1.48153 WP_002357926.1.49392 WP_002357926.1.4975 WP_002357926.1.50160 WP_002357926.1.50513 WP_002357926.1.50810 WP_002357926.1.5083 WP_002357926.1.51046 WP_002357926.1.51712 WP_002357926.1.53989 WP_002357926.1.53992 WP_002357926.1.54795 WP_002357926.1.54998 WP_002357926.1.56483 WP_002357926.1.56974 WP_002357926.1.57163 WP_002357926.1.57671 WP_002357926.1.57758 WP_002357926.1.57968 WP_002357926.1.58089 WP_002357926.1.58766 WP_002357926.1.59645 WP_002357926.1.59658 WP_002357926.1.59690 WP_002357926.1.60220 WP_002357926.1.60422 WP_002357926.1.60579 WP_002357926.1.61089 WP_002357926.1.61103 WP_002357926.1.61180 WP_002357926.1.6167 WP_002357926.1.61932 WP_002357926.1.62644 WP_002357926.1.63477 WP_002357926.1.63579 WP_002357926.1.64022 WP_002357926.1.64483 WP_002357926.1.65210 WP_002357926.1.65461 WP_002357926.1.6626 WP_002357926.1.66767 WP_002357926.1.6682 WP_002357926.1.66845 WP_002357926.1.67436 WP_002357926.1.67716 WP_002357926.1.68409 WP_002357926.1.68746 WP_002357926.1.68828 WP_002357926.1.6893 WP_002357926.1.68935 WP_002357926.1.69521 WP_002357926.1.70675 WP_002357926.1.7118 WP_002357926.1.71303 WP_002357926.1.71510 WP_002357926.1.72058 WP_002357926.1.72635 WP_002357926.1.73817 WP_002357926.1.74362 WP_002357926.1.75949 WP_002357926.1.76646 WP_002357926.1.76958 WP_002357926.1.77302 WP_002357926.1.77327 WP_002357926.1.77357 WP_002357926.1.77956 WP_002357926.1.7815 WP_002357926.1.78447 WP_002357926.1.78471 WP_002357926.1.78587 WP_002357926.1.79457 WP_002357926.1.79975 WP_002357926.1.80396 WP_002357926.1.8058 WP_002357926.1.81312 WP_002357926.1.8179 WP_002357926.1.81880 WP_002357926.1.81991 WP_002357926.1.82202 WP_002357926.1.83032 WP_002357926.1.83327 WP_002357926.1.83649 WP_002357926.1.83953 WP_002357926.1.84380 WP_002357926.1.84573 WP_002357926.1.84813 WP_002357926.1.85465 WP_002357926.1.85534 WP_002357926.1.85848 WP_002357926.1.86904 WP_002357926.1.87000 WP_002357926.1.87252 WP_002357926.1.87482 WP_002357926.1.87855 WP_002357926.1.88329 WP_002357926.1.88661 WP_002357926.1.89060 WP_002357926.1.89088 WP_002357926.1.89321 WP_002357926.1.89431 WP_002357926.1.90100 WP_002357926.1.90642 WP_002357926.1.91092 WP_002357926.1.91555 WP_002357926.1.9159 WP_002357926.1.91608 WP_002357926.1.91813 WP_002357926.1.91925 WP_002357926.1.92073 WP_002357926.1.92581 WP_002357926.1.92820 WP_002357926.1.93642 WP_002357926.1.93977 WP_002357926.1.94612 WP_002357926.1.95143 WP_002357926.1.95212 WP_002357926.1.95228 WP_002357926.1.95935 WP_002357926.1.96320 WP_002357926.1.96467 WP_002357926.1.96764 WP_002357926.1.96987 WP_002357926.1.97828 WP_002357926.1.98122 WP_002357926.1.9842 WP_002357926.1.98652 WP_002357926.1.98840 WP_002357926.1.99748 gi|428766716|ref|YP_007152827.1| gi|479179955|ref|YP_007807264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]