SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1nvpC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nvpC
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.81e-24
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nvpC   PDB: 1nvp   SUPERFAMILY: 1nvpC
Sequence length 76
Comment (C:)
Sequence
gsgaedgqveeeplnseddvsdeegqelfdtenvvvcqydkihrsknkwkfhlkdgimnl
ngrdyifskaigdaew
Download sequence
Identical sequences 1nvpC 1nvp_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]