SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1nvpD from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nvpD
Domain Number 1 Region: 51-100
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.93e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 2-52
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 8.64e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nvpD   PDB: 1nvp
Sequence length 108
Comment (D:)
Sequence
ayqlyrnttlgnslqesldeliqsqqitpqlalqvllqfdkainaalaqrvrnrvnfrgs
lntyrfcdnvwtfvlndvefrevtelikvdkvkivacdgkntgsntte
Download sequence
Identical sequences 1nvpD 1nvp_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]