SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1o0lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o0lA
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 1.84e-59
Family Bcl-2 inhibitors of programmed cell death 0.000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1o0lA   PDB: 1o0l   SUPERFAMILY: 1o0lA
Sequence length 188
Comment (A:)
Sequence
gplgsmatpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefet
rfrrtfsdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkem
eplvgqvqewmveyletrladwihssggwaeftalygdgaleearrlregnwasvrtvlt
gavalgal
Download sequence
Identical sequences 1o0lA 001157185|e1o0lA2|5000.3.1.2|A:1-188 cath|current|1o0lA00/-4-183 1o0l_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]