SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1o5wA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o5wA
Domain Number 1 Region: 21-327,431-472
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-75
Family FAD-linked reductases, N-terminal domain 0.0000000000371
Further Details:      
 
Domain Number 2 Region: 307-417
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.33e-36
Family L-aminoacid/polyamine oxidase 0.000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1o5wA   PDB: 1o5w
Sequence length 534
Comment (A:)
Sequence
mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
Download sequence
Identical sequences 1o5wA 1o5w_A 1o5w_B 1o5w_C 1o5w_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]