SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ojtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ojtA
Domain Number 1 Region: 4-349
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.04e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000176
Further Details:      
 
Domain Number 2 Region: 358-468
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.13e-50
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ojtA   PDB: 1ojt
Sequence length 482
Comment (A:)
Sequence
gsadaeydvvvlgggpggysaafaaadeglkvaiveryktlggvclnvgcipskallhna
avidevrhlaangikypepeldidmlraykdgvvsrltgglagmaksrkvdviqgdgqfl
dphhlevsltagdayeqaaptgekkivafknciiaagsrvtklpfipedpriidssgala
lkevpgklliigggiiglemgtvystlgsrldvvemmdglmqgadrdlvkvwqkqneyrf
dnimvntktvavepkedgvyvtfeganapkepqrydavlvaagrapngklisaekagvav
tdrgfievdkqmrtnvphiyaigdivgqpmlahkavheghvaaencaghkayfdarvipg
vaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifdaetgrii
gggivgpnggdmigevclaiemgcdaadigktihphptlgesigmaaevalgtctdlppq
kk
Download sequence
Identical sequences 1ojt_A 1ojtA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]