SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1p2eA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1p2eA
Domain Number 1 Region: 123-382,509-570
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.28e-61
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000000594
Further Details:      
 
Domain Number 2 Region: 361-505
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.07e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000000969
Further Details:      
 
Domain Number 3 Region: 6-92
Classification Level Classification E-value
Superfamily Multiheme cytochromes 9.07e-17
Family Di-heme elbow motif 0.00000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1p2eA   PDB: 1p2e
Sequence length 571
Comment (A:)
Sequence
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
afpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
yiqahptlsvkggvmvteavrgngailvnregkrfvneittrdkasaailaqtgksayli
fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
ganrlggnaisdiitfgrlageeaakyskkn
Download sequence
Identical sequences 1p2e_A 1p2eA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]