SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1pbeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pbeA
Domain Number 1 Region: 1-172,274-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.37e-58
Family FAD-linked reductases, N-terminal domain 0.000000000209
Further Details:      
 
Domain Number 2 Region: 175-275
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.95e-46
Family PHBH-like 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pbeA   PDB: 1pbe
Sequence length 394
Comment (A:)
Sequence
MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAG
VDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATT
VYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERV
YPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFW
TELKARLPAEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLN
LAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFS
QRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE
Download sequence
Identical sequences A0A233TK29 P00438 V6A7D3 W1MW74
1pbeA gi|558669665|ref|YP_008806375.1| gi|514407857|ref|YP_008130709.1| gi|386063226|ref|YP_005978530.1| gi|558676016|ref|YP_008812724.1| 1pbe_A 1pdh_A 1phh_A 2phh_A WP_003084095.1.100100 WP_003084095.1.100469 WP_003084095.1.100476 WP_003084095.1.101590 WP_003084095.1.10174 WP_003084095.1.101781 WP_003084095.1.10271 WP_003084095.1.10482 WP_003084095.1.10684 WP_003084095.1.10764 WP_003084095.1.11130 WP_003084095.1.1183 WP_003084095.1.11854 WP_003084095.1.12081 WP_003084095.1.12200 WP_003084095.1.12530 WP_003084095.1.12660 WP_003084095.1.12670 WP_003084095.1.12797 WP_003084095.1.12890 WP_003084095.1.12930 WP_003084095.1.13077 WP_003084095.1.13092 WP_003084095.1.13266 WP_003084095.1.13270 WP_003084095.1.13364 WP_003084095.1.13533 WP_003084095.1.13642 WP_003084095.1.14116 WP_003084095.1.14204 WP_003084095.1.14476 WP_003084095.1.14679 WP_003084095.1.14690 WP_003084095.1.14797 WP_003084095.1.14981 WP_003084095.1.1516 WP_003084095.1.15328 WP_003084095.1.15408 WP_003084095.1.15482 WP_003084095.1.15666 WP_003084095.1.1704 WP_003084095.1.17189 WP_003084095.1.17499 WP_003084095.1.1758 WP_003084095.1.1761 WP_003084095.1.18054 WP_003084095.1.18732 WP_003084095.1.18795 WP_003084095.1.19346 WP_003084095.1.19930 WP_003084095.1.20342 WP_003084095.1.20590 WP_003084095.1.20854 WP_003084095.1.21002 WP_003084095.1.21039 WP_003084095.1.21253 WP_003084095.1.22324 WP_003084095.1.22365 WP_003084095.1.2237 WP_003084095.1.22390 WP_003084095.1.22394 WP_003084095.1.23191 WP_003084095.1.2355 WP_003084095.1.23938 WP_003084095.1.24319 WP_003084095.1.24940 WP_003084095.1.25271 WP_003084095.1.25641 WP_003084095.1.26010 WP_003084095.1.26473 WP_003084095.1.26553 WP_003084095.1.27073 WP_003084095.1.27288 WP_003084095.1.27549 WP_003084095.1.27825 WP_003084095.1.27933 WP_003084095.1.28057 WP_003084095.1.28193 WP_003084095.1.28699 WP_003084095.1.28713 WP_003084095.1.28800 WP_003084095.1.28878 WP_003084095.1.29008 WP_003084095.1.29070 WP_003084095.1.29127 WP_003084095.1.2927 WP_003084095.1.29440 WP_003084095.1.29633 WP_003084095.1.29650 WP_003084095.1.2980 WP_003084095.1.29920 WP_003084095.1.29958 WP_003084095.1.29973 WP_003084095.1.30020 WP_003084095.1.30081 WP_003084095.1.3030 WP_003084095.1.30693 WP_003084095.1.30842 WP_003084095.1.30994 WP_003084095.1.31633 WP_003084095.1.3172 WP_003084095.1.31732 WP_003084095.1.31751 WP_003084095.1.31848 WP_003084095.1.32235 WP_003084095.1.32626 WP_003084095.1.32821 WP_003084095.1.32869 WP_003084095.1.32998 WP_003084095.1.33009 WP_003084095.1.3351 WP_003084095.1.33521 WP_003084095.1.33547 WP_003084095.1.33728 WP_003084095.1.3385 WP_003084095.1.33945 WP_003084095.1.34150 WP_003084095.1.34203 WP_003084095.1.34461 WP_003084095.1.3452 WP_003084095.1.34568 WP_003084095.1.34583 WP_003084095.1.35104 WP_003084095.1.35231 WP_003084095.1.35529 WP_003084095.1.3555 WP_003084095.1.35599 WP_003084095.1.36285 WP_003084095.1.36435 WP_003084095.1.3653 WP_003084095.1.36708 WP_003084095.1.36756 WP_003084095.1.37050 WP_003084095.1.37172 WP_003084095.1.37416 WP_003084095.1.3742 WP_003084095.1.37698 WP_003084095.1.37703 WP_003084095.1.3773 WP_003084095.1.38319 WP_003084095.1.38335 WP_003084095.1.38505 WP_003084095.1.38582 WP_003084095.1.38932 WP_003084095.1.39811 WP_003084095.1.39920 WP_003084095.1.40115 WP_003084095.1.40237 WP_003084095.1.40271 WP_003084095.1.41137 WP_003084095.1.41199 WP_003084095.1.41290 WP_003084095.1.41703 WP_003084095.1.41725 WP_003084095.1.4196 WP_003084095.1.42 WP_003084095.1.42041 WP_003084095.1.42047 WP_003084095.1.42381 WP_003084095.1.42388 WP_003084095.1.42411 WP_003084095.1.42463 WP_003084095.1.42634 WP_003084095.1.42690 WP_003084095.1.42723 WP_003084095.1.4273 WP_003084095.1.42952 WP_003084095.1.43212 WP_003084095.1.43315 WP_003084095.1.43326 WP_003084095.1.43696 WP_003084095.1.4381 WP_003084095.1.44269 WP_003084095.1.445 WP_003084095.1.44552 WP_003084095.1.44804 WP_003084095.1.44870 WP_003084095.1.45312 WP_003084095.1.45353 WP_003084095.1.45611 WP_003084095.1.45635 WP_003084095.1.45636 WP_003084095.1.45678 WP_003084095.1.45723 WP_003084095.1.45946 WP_003084095.1.4640 WP_003084095.1.46935 WP_003084095.1.47374 WP_003084095.1.47551 WP_003084095.1.48321 WP_003084095.1.48487 WP_003084095.1.48579 WP_003084095.1.48810 WP_003084095.1.48840 WP_003084095.1.4913 WP_003084095.1.49244 WP_003084095.1.49922 WP_003084095.1.50232 WP_003084095.1.50450 WP_003084095.1.50459 WP_003084095.1.50783 WP_003084095.1.50922 WP_003084095.1.51173 WP_003084095.1.51472 WP_003084095.1.51928 WP_003084095.1.52212 WP_003084095.1.52372 WP_003084095.1.52403 WP_003084095.1.52409 WP_003084095.1.52591 WP_003084095.1.52697 WP_003084095.1.52790 WP_003084095.1.5289 WP_003084095.1.52939 WP_003084095.1.53038 WP_003084095.1.53070 WP_003084095.1.53414 WP_003084095.1.53586 WP_003084095.1.5388 WP_003084095.1.53946 WP_003084095.1.5399 WP_003084095.1.54003 WP_003084095.1.54076 WP_003084095.1.54248 WP_003084095.1.5427 WP_003084095.1.54354 WP_003084095.1.55 WP_003084095.1.55445 WP_003084095.1.55976 WP_003084095.1.56864 WP_003084095.1.57065 WP_003084095.1.57339 WP_003084095.1.57417 WP_003084095.1.57921 WP_003084095.1.58056 WP_003084095.1.58527 WP_003084095.1.5856 WP_003084095.1.58581 WP_003084095.1.5869 WP_003084095.1.5897 WP_003084095.1.59156 WP_003084095.1.59288 WP_003084095.1.59339 WP_003084095.1.59385 WP_003084095.1.59943 WP_003084095.1.60679 WP_003084095.1.60910 WP_003084095.1.60970 WP_003084095.1.61288 WP_003084095.1.61589 WP_003084095.1.616 WP_003084095.1.626 WP_003084095.1.62961 WP_003084095.1.63784 WP_003084095.1.63929 WP_003084095.1.63941 WP_003084095.1.64340 WP_003084095.1.64433 WP_003084095.1.6450 WP_003084095.1.64605 WP_003084095.1.64611 WP_003084095.1.65478 WP_003084095.1.65679 WP_003084095.1.65779 WP_003084095.1.66088 WP_003084095.1.66277 WP_003084095.1.66563 WP_003084095.1.66693 WP_003084095.1.67124 WP_003084095.1.67269 WP_003084095.1.67874 WP_003084095.1.67937 WP_003084095.1.6796 WP_003084095.1.68446 WP_003084095.1.68448 WP_003084095.1.68472 WP_003084095.1.68790 WP_003084095.1.68881 WP_003084095.1.6911 WP_003084095.1.69209 WP_003084095.1.6937 WP_003084095.1.69411 WP_003084095.1.69556 WP_003084095.1.70138 WP_003084095.1.70168 WP_003084095.1.70331 WP_003084095.1.70650 WP_003084095.1.71203 WP_003084095.1.71234 WP_003084095.1.71290 WP_003084095.1.71346 WP_003084095.1.71412 WP_003084095.1.71610 WP_003084095.1.71862 WP_003084095.1.71866 WP_003084095.1.72183 WP_003084095.1.7219 WP_003084095.1.72477 WP_003084095.1.72662 WP_003084095.1.72782 WP_003084095.1.72845 WP_003084095.1.73035 WP_003084095.1.73192 WP_003084095.1.73719 WP_003084095.1.74 WP_003084095.1.74072 WP_003084095.1.74264 WP_003084095.1.74287 WP_003084095.1.74475 WP_003084095.1.74637 WP_003084095.1.74878 WP_003084095.1.74941 WP_003084095.1.7501 WP_003084095.1.75389 WP_003084095.1.7568 WP_003084095.1.75756 WP_003084095.1.76791 WP_003084095.1.77442 WP_003084095.1.77476 WP_003084095.1.77686 WP_003084095.1.78104 WP_003084095.1.78112 WP_003084095.1.78148 WP_003084095.1.78425 WP_003084095.1.78599 WP_003084095.1.78623 WP_003084095.1.78986 WP_003084095.1.7899 WP_003084095.1.79003 WP_003084095.1.79060 WP_003084095.1.79279 WP_003084095.1.79286 WP_003084095.1.79421 WP_003084095.1.79429 WP_003084095.1.79699 WP_003084095.1.79883 WP_003084095.1.79902 WP_003084095.1.8 WP_003084095.1.80068 WP_003084095.1.8013 WP_003084095.1.80258 WP_003084095.1.80572 WP_003084095.1.80715 WP_003084095.1.80892 WP_003084095.1.80926 WP_003084095.1.80969 WP_003084095.1.81237 WP_003084095.1.81331 WP_003084095.1.81338 WP_003084095.1.81349 WP_003084095.1.81380 WP_003084095.1.8141 WP_003084095.1.8238 WP_003084095.1.82606 WP_003084095.1.82686 WP_003084095.1.82798 WP_003084095.1.82810 WP_003084095.1.83267 WP_003084095.1.83317 WP_003084095.1.8351 WP_003084095.1.8353 WP_003084095.1.83673 WP_003084095.1.83871 WP_003084095.1.83937 WP_003084095.1.84138 WP_003084095.1.84526 WP_003084095.1.84589 WP_003084095.1.84684 WP_003084095.1.84825 WP_003084095.1.84865 WP_003084095.1.85311 WP_003084095.1.85978 WP_003084095.1.86182 WP_003084095.1.86243 WP_003084095.1.8645 WP_003084095.1.86506 WP_003084095.1.86595 WP_003084095.1.8693 WP_003084095.1.87182 WP_003084095.1.87463 WP_003084095.1.8777 WP_003084095.1.87877 WP_003084095.1.87975 WP_003084095.1.889 WP_003084095.1.89868 WP_003084095.1.89992 WP_003084095.1.90272 WP_003084095.1.90655 WP_003084095.1.91012 WP_003084095.1.91236 WP_003084095.1.91281 WP_003084095.1.91307 WP_003084095.1.91796 WP_003084095.1.91882 WP_003084095.1.91943 WP_003084095.1.9219 WP_003084095.1.92594 WP_003084095.1.93001 WP_003084095.1.93130 WP_003084095.1.93196 WP_003084095.1.93520 WP_003084095.1.94065 WP_003084095.1.94288 WP_003084095.1.94450 WP_003084095.1.94732 WP_003084095.1.94742 WP_003084095.1.94881 WP_003084095.1.94943 WP_003084095.1.95056 WP_003084095.1.95132 WP_003084095.1.95354 WP_003084095.1.95994 WP_003084095.1.96863 WP_003084095.1.97204 WP_003084095.1.97461 WP_003084095.1.97488 WP_003084095.1.97499 WP_003084095.1.97503 WP_003084095.1.97521 WP_003084095.1.97583 WP_003084095.1.97784 WP_003084095.1.97826 WP_003084095.1.98276 WP_003084095.1.98907 WP_003084095.1.9989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]