SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1pdnC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pdnC
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily Homeodomain-like 2.74e-41
Family Paired domain 0.000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pdnC   PDB: 1pdn   SUPERFAMILY: 1pdnC
Sequence length 128
Comment (C:)
Sequence
gqgrvnqlggvfingrplpnnirlkivemaadgirpcvisrqlrvshgcvskilnryqet
gsirpgviggskpriatpeienrieeykrsspgmfsweirekliregvcdrstapsvsai
srlvrgrd
Download sequence
Identical sequences 1pdnC 1pdn_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]