SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1pn0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pn0A
Domain Number 1 Region: 467-661
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.3e-63
Family Glutathione peroxidase-like 0.00000000305
Further Details:      
 
Domain Number 2 Region: 5-245,346-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.63e-59
Family FAD-linked reductases, N-terminal domain 0.0000000000107
Further Details:      
 
Domain Number 3 Region: 242-342
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9e-37
Family PHBH-like 0.000000992
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pn0A   PDB: 1pn0
Sequence length 665
Comment (A:)
Sequence
mtkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcr
tleslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgr
ierrildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqf
ghktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfem
igeqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekg
grvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdac
hthspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfs
rlfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncv
vgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsen
svisrytpkgadrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhph
pksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadw
tksta
Download sequence
Identical sequences 1pn0_A 1pn0_B 1pn0_C 1pn0_D 1pn0A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]