SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1pnsJ from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pnsJ
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily Ribosomal protein S10 1.39e-35
Family Ribosomal protein S10 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pnsJ   PDB: 1pns   SUPERFAMILY: 1pnsJ
Sequence length 98
Comment (J:)
Sequence
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt
Download sequence
Identical sequences 1pnsJ 4gkj_J 4gkk_J 4jv5_J 4jya_J 4khp_J 4v49_AJ 4v4a_AJ 4v4g_AJ 4v4g_CJ 4v4g_EJ 4v4g_GJ 4v4g_IJ 4v7p_AJ 4v7p_DJ 4v83_AJ 4v83_CJ 4v84_AJ 4v84_CJ 4v9h_AJ 4v9i_AJ 4v9i_CJ 4v9n_AJ 4v9n_CJ 4v9q_BJ 4v9q_DJ 4wt8_AJ 4wt8_BJ 4xej_AS10 4xej_BS10 5a9z_BN 5aa0_BN 5wnq_J 5wnr_J 5wns_J 6cap_J 6caq_J 000005124|e2uubJ1|304.44.1.1|J:3-100 000064312|e1yl4M1|304.44.1.1|M:3-100 000064313|e2j02J1|304.44.1.1|J:3-100 000064315|e2b64J1|304.44.1.1|J:3-100 000064316|e1hnxJ1|304.44.1.1|J:3-100 000064318|e2b9mJ1|304.44.1.1|J:3-100 000064319|e2uu9J1|304.44.1.1|J:3-100 000064320|e3d5aJ1|304.44.1.1|J:3-100 000064321|e2hgrM1|304.44.1.1|M:3-100 000064322|e1n36J1|304.44.1.1|J:2-99 000064323|e1i96J1|304.44.1.1|J:2-99 000064324|e2v48J1|304.44.1.1|J:3-100 000064325|e1n33J1|304.44.1.1|J:2-99 000064326|e2f4vJ1|304.44.1.1|J:3-100 000064327|e1i95J1|304.44.1.1|J:2-99 000064328|e2uxdJ1|304.44.1.1|J:3-100 000064329|e1fjgJ1|304.44.1.1|J:3-100 000064332|e2hgiM1|304.44.1.1|M:3-100 000064333|e1n32J1|304.44.1.1|J:2-99 000064334|e2v46J1|304.44.1.1|J:3-100 000064335|e2vqfJ1|304.44.1.1|J:3-100 000064338|e2hhhJ1|304.44.1.1|J:3-100 000064339|e1hnzJ1|304.44.1.1|J:3-100 000064340|e2j00J1|304.44.1.1|J:3-100 000064341|e1xmqJ1|304.44.1.1|J:3-100 000064345|e1hr0J1|304.44.1.1|J:3-100 000064347|e2b9oJ1|304.44.1.1|J:3-100 000064349|e3d5cJ1|304.44.1.1|J:3-100 000064350|e2uucJ1|304.44.1.1|J:3-100 000064352|e1j5eJ1|304.44.1.1|J:2-99 000064353|e2vqeJ1|304.44.1.1|J:3-100 000064354|e2hgpM1|304.44.1.1|M:3-100 000064357|e1n34J1|304.44.1.1|J:2-99 000064359|e2uxbJ1|304.44.1.1|J:3-100 000064362|e2e5lJ1|304.44.1.1|J:2-99 000064365|e1hnwJ1|304.44.1.1|J:3-100 000064367|e2uuaJ1|304.44.1.1|J:3-100 000064368|e1xnrJ1|304.44.1.1|J:3-100 000064371|e1xnqJ1|304.44.1.1|J:3-100 000064373|e1xmoJ1|304.44.1.1|J:3-100 000064374|e1i97J1|304.44.1.1|J:2-99 000064375|e1i94J1|304.44.1.1|J:2-99 000064376|e2uxcJ1|304.44.1.1|J:3-100 000155520|e1voqJ1|304.44.1.1|J:1-98 000222920|e4duyJ1|304.44.1.1|J:3-100 000274028|e1vosJ1|304.44.1.1|J:1-98 000274085|e1vovJ1|304.44.1.1|J:1-98 000274142|e1voxJ1|304.44.1.1|J:1-98 000274199|e1vozJ1|304.44.1.1|J:1-98 000320032|e2ow8k1|304.44.1.1|k:3-100 000331328|e2qnhk1|304.44.1.1|k:3-100 000354365|e3f1eJ1|304.44.1.1|J:3-100 000354425|e3f1gJ1|304.44.1.1|J:3-100 000361339|e2zm6J1|304.44.1.1|J:2-99 000379375|e3kiqj1|304.44.1.1|j:3-100 000379432|e3kisj1|304.44.1.1|j:3-100 000379489|e3kiuj1|304.44.1.1|j:3-100 000379546|e3kixj1|304.44.1.1|j:3-100 000395266|e3mr8J1|304.44.1.1|J:1-98 000395325|e3ms0J1|304.44.1.1|J:1-98 000401776|e3otoJ1|304.44.1.1|J:3-100 000405940|e2xqdJ1|304.44.1.1|J:3-100 000407560|e2xsyJ1|304.44.1.1|J:3-100 000407686|e2xuyJ1|304.44.1.1|J:3-100 000412362|e3pynJ1|304.44.1.1|J:1-98 000412416|e3pyqJ1|304.44.1.1|J:1-98 000412470|e3pysJ1|304.44.1.1|J:1-98 000412524|e3pyuJ1|304.44.1.1|J:1-98 000414348|e2y0uJ1|304.44.1.1|J:3-100 000414406|e2y0wJ1|304.44.1.1|J:3-100 000414464|e2y0yJ1|304.44.1.1|J:3-100 000414522|e2y10J1|304.44.1.1|J:3-100 000414580|e2y12J1|304.44.1.1|J:3-100 000414638|e2y14J1|304.44.1.1|J:3-100 000414696|e2y16J1|304.44.1.1|J:3-100 000414754|e2y18J1|304.44.1.1|J:3-100 000437428|e1gixM1|304.44.1.1|M:3-100 000437526|e1ibkJ1|304.44.1.1|J:3-100 000437548|e1iblJ1|304.44.1.1|J:3-100 000437570|e1ibmJ1|304.44.1.1|J:3-100 000437675|e1jgoM1|304.44.1.1|M:3-100 000437697|e1jgpM1|304.44.1.1|M:3-100 000437719|e1jgqM1|304.44.1.1|M:3-100 000438998|e1ml5M1|304.44.1.1|M:3-100 000440632|e1pnsJ1|304.44.1.1|J:1-98 000440686|e1pnxJ1|304.44.1.1|J:1-98 001017050|e4gkjJ1|304.44.1.1|J:1-98 001017051|e4gkkJ1|304.44.1.1|J:1-98 001017052|e4khpJ1|304.44.1.1|J:1-98 001064270|e4juwJ1|304.44.1.1|J:1-98 001064342|e4jv5J1|304.44.1.1|J:1-98 001064370|e4jyaJ1|304.44.1.1|J:1-98 001064869|e4k0lJ1|304.44.1.1|J:1-98 001064925|e4k0pJ1|304.44.1.1|J:1-98 001065504|e4kfhJ1|304.44.1.1|J:1-98 001065564|e4kfkJ1|304.44.1.1|J:1-98 001086663|e4l6kJ1|304.44.1.1|J:1-98 001086717|e4l6mJ1|304.44.1.1|J:1-98 001110628|e4ji0J1|304.44.1.1|J:3-100 001110650|e4ji1J1|304.44.1.1|J:3-100 001110672|e4ji2J1|304.44.1.1|J:3-100 001110694|e4ji3J1|304.44.1.1|J:3-100 001110716|e4ji4J1|304.44.1.1|J:3-100 001110738|e4ji5J1|304.44.1.1|J:3-100 001110760|e4ji6J1|304.44.1.1|J:3-100 001110782|e4ji7J1|304.44.1.1|J:3-100 001110804|e4ji8J1|304.44.1.1|J:3-100 001285119|e4ox9J1|304.44.1.1|J:2-99 001293008|e4nxmJ1|304.44.1.1|J:3-100 001293030|e4nxnJ1|304.44.1.1|J:3-100 001294322|e4kvbJ1|304.44.1.1|J:3-100 001427992|e4v42AM1|304.44.1.1|AM:3-100 001428503|e4v49AJ1|304.44.1.1|AJ:1-98 001428560|e4v4aAJ1|304.44.1.1|AJ:1-98 001428940|e4v4gAJ1|304.44.1.1|AJ:1-98 001428941|e4v4gCJ1|304.44.1.1|CJ:1-98 001428942|e4v4gEJ1|304.44.1.1|EJ:1-98 001428943|e4v4gGJ1|304.44.1.1|GJ:1-98 001428944|e4v4gIJ1|304.44.1.1|IJ:1-98 001429330|e4v4ik1|304.44.1.1|k:3-100 001429384|e4v4jk1|304.44.1.1|k:3-100 001429751|e4v4pBM1|304.44.1.1|BM:3-100 001429885|e4v4rAJ1|304.44.1.1|AJ:3-100 001429943|e4v4sAJ1|304.44.1.1|AJ:3-100 001430001|e4v4tAJ1|304.44.1.1|AJ:3-100 001430199|e4v4xAM1|304.44.1.1|AM:3-100 001430257|e4v4yAM1|304.44.1.1|AM:3-100 001430315|e4v4zAM1|304.44.1.1|AM:3-100 001432747|e4v5lAJ1|304.44.1.1|AJ:3-100 001432805|e4v5mAJ1|304.44.1.1|AJ:3-100 001432868|e4v5nAJ1|304.44.1.1|AJ:3-100 001433026|e4v5pAJ1|304.44.1.1|AJ:3-100 001433027|e4v5pCJ1|304.44.1.1|CJ:3-100 001433142|e4v5qAJ1|304.44.1.1|AJ:3-100 001433143|e4v5qCJ1|304.44.1.1|CJ:3-100 001433258|e4v5rAJ1|304.44.1.1|AJ:3-100 001433259|e4v5rCJ1|304.44.1.1|CJ:3-100 001433374|e4v5sAJ1|304.44.1.1|AJ:3-100 001433375|e4v5sCJ1|304.44.1.1|CJ:3-100 001434665|e4v63AJ1|304.44.1.1|AJ:3-100 001434666|e4v63CJ1|304.44.1.1|CJ:3-100 001435009|e4v67AJ1|304.44.1.1|AJ:3-100 001435010|e4v67CJ1|304.44.1.1|CJ:3-100 001438404|e4v7jAj1|304.44.1.1|Aj:3-100 001438405|e4v7jBj1|304.44.1.1|Bj:3-100 001438520|e4v7kAj1|304.44.1.1|Aj:3-100 001438521|e4v7kBj1|304.44.1.1|Bj:3-100 001439004|e4v7pAJ1|304.44.1.1|AJ:1-98 001439005|e4v7pDJ1|304.44.1.1|DJ:1-98 001440431|e4v83AJ1|304.44.1.1|AJ:1-98 001440432|e4v83CJ1|304.44.1.1|CJ:1-98 001440539|e4v84AJ1|304.44.1.1|AJ:1-98 001440540|e4v84CJ1|304.44.1.1|CJ:1-98 001445467|e4v9hAJ1|304.44.1.1|AJ:1-98 001445551|e4v9iAJ1|304.44.1.1|AJ:1-98 001445552|e4v9iCJ1|304.44.1.1|CJ:1-98 001446167|e4v9nAJ1|304.44.1.1|AJ:1-98 001446168|e4v9nCJ1|304.44.1.1|CJ:1-98 001446829|e4v9qBJ1|304.44.1.1|BJ:1-98 001446830|e4v9qDJ1|304.44.1.1|DJ:1-98 001490219|e4wusJ1|304.44.1.1|J:1-98 001501486|e4xejAS101|304.44.1.1|AS10:1-98 001503039|e4xejBS101|304.44.1.1|BS10:1-98 001694752|e5aa0BN1|304.44.1.1|BN:1-98 001694833|e5d8bKA1|304.44.1.1|KA:3-100 001694834|e5d8bGC1|304.44.1.1|GC:3-100 001697114|e5a9zBN1|304.44.1.1|BN:1-98 001832020|e5imqN1|304.44.1.1|N:3-100 001832077|e5imrN1|304.44.1.1|N:3-100 001832666|e5j4dSA1|304.44.1.1|SA:3-100 001832667|e5j4dXC1|304.44.1.1|XC:3-100 001856142|e4wt8AJ1|304.44.1.1|AJ:1-98 001856143|e4wt8BJ1|304.44.1.1|BJ:1-98 001862412|e4yy3J1|304.44.1.1|J:3-100 001889050|e5lmnJ1|304.44.1.1|J:3-100 001889075|e5lmoJ1|304.44.1.1|J:3-100 001889100|e5lmpJ1|304.44.1.1|J:3-100 001889125|e5lmqJ1|304.44.1.1|J:3-100 001889150|e5lmrJ1|304.44.1.1|J:3-100 001889175|e5lmsJ1|304.44.1.1|J:3-100 001889200|e5lmtJ1|304.44.1.1|J:3-100 001889225|e5lmuJ1|304.44.1.1|J:3-100 001889249|e5lmvJ1|304.44.1.1|J:3-100 d1fjgj_ d1hnwj_ d1hnxj_ d1hnzj_ d1hr0j_ d1i94j_ d1i95j_ d1i96j_ d1i97j_ d1j5ej_ d1n32j_ d1n33j_ d1n34j_ d1n36j_ d1xmoj_ d1xmqj_ d1xnqj_ d1xnrj_ d1yl4m1 d2b64j1 d2b9mj1 d2b9oj1 d2e5lj1 d2f4vj1 d2hgim1 d2hgpm1 d2hgrm1 d2hhhj1 d2j00j1 d2j02j1 d2ow8k1 d2qnhk1 d2uu9j1 d2uuaj1 d2uubj1 d2uucj1 d2uxbj1 d2uxcj1 d2uxdj1 d2v46j1 d2v48j1 d2vqej1 d2vqfj1 d3d5aj1 d3d5cj1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]