SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1pwuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pwuA
Domain Number 1 Region: 27-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.55e-101
Family Anthrax toxin lethal factor, N- and C-terminal domains 0.000000000518
Further Details:      
 
Domain Number 2 Region: 266-550
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.56e-77
Family ADP-ribosylating toxins 0.000000000119
Further Details:      
 
Domain Number 3 Region: 551-772
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.43e-51
Family Anthrax toxin lethal factor, N- and C-terminal domains 0.00000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pwuA   PDB: 1pwu
Sequence length 776
Comment (A:)
Sequence
agghgdvgmhvkekeknkdenkrkdeernktqeehlkeimkhivkievkgeeavkkeaae
kllekvpsdvlemykaiggkiyivdgditkhislealsedkkkikdiygkdallhehyvy
akegyepvlviqssedyventekalnvyyeigkilsrdilskinqpyqkfldvlntikna
sdsdgqdllftnqlkehptdfsvefleqnsnevqevfakafayyiepqhrdvlqlyapea
fnymdkfneqeinlsleelkdqrmlsryekwekikqhyqhwsdslseegrgllkklqipi
epkkddiihslsqeekellkriqidssdflsteekeflkklqidirdslseeekellnri
qvdssnplsekekeflkklkldiqpydinqrlqdtgglidspsinldvrkqykrdiqnid
allhqsigstlynkiylyenmninnltatlgadlvdstdntkinrgifnefkknfkysis
snymivdinerpaldnerlkwriqlspdtragylengklilqrnigleikdvqiikqsek
eyiridakvvpkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesay
lilnewknniqsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyv
pesrsillhgpskgvelrndsegfihcfghavddyagylldknqsdlvtnskkfidifke
egsnltsygrtneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins
Download sequence
Identical sequences 1pwu_A 1pwu_B 1pww_A 1pww_B 1pwuA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]