SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1pxaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pxaA
Domain Number 1 Region: 1-172,274-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-57
Family FAD-linked reductases, N-terminal domain 0.000000000219
Further Details:      
 
Domain Number 2 Region: 175-275
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.42e-46
Family PHBH-like 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pxaA   PDB: 1pxa
Sequence length 394
Comment (A:)
Sequence
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekvedwsderfw
telkarlpsevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgld
laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
qriqqteleyylgseaglatiaenyvglpyeeie
Download sequence
Identical sequences 1pxaA 1pxa_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]