SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1q1rA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q1rA
Domain Number 1 Region: 6-168,197-345
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.86e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000471
Further Details:      
 
Domain Number 2 Region: 325-417
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.7e-28
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1q1rA   PDB: 1q1r
Sequence length 431
Comment (A:)
Sequence
mnandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkatae
slylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrprplpva
sgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmhvtlldt
aarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedgtrlpad
lviagiglipncelasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvrie
svpnaleqarkiaailcgkvprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpd
fsvfylqgdrvlavdtvnrpvefnqskqiitdrlpvepnllgdesvplkeiiaaakaels
saparhhhhhh
Download sequence
Identical sequences 1q1r_A 1q1r_B 1q1w_A 1q1w_B 1q1rA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]