SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1q59A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q59A
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 7.43e-53
Family Bcl-2 inhibitors of programmed cell death 0.0000000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1q59A   PDB: 1q59   SUPERFAMILY: 1q59A
Sequence length 172
Comment (A:)
Sequence
maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlleeiier
nsetftetwnrfithtehvdldfnsvfleifhrgdpslgralawmawcmhacrtlccnqs
tpyyvvdlsvrgmleasegldgwihqqggwstliednipgddddlehhhhhh
Download sequence
Identical sequences 1q59_A 1q59A 000003316|e1q59A1|5000.3.1.1|A:1-172 cath|current|1q59A00/1-172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]