SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1q7fA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q7fA
Domain Number 1 Region: 12-279
Classification Level Classification E-value
Superfamily NHL repeat 2.49e-36
Family NHL repeat 0.0000000000722
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1q7fA   PDB: 1q7f   SUPERFAMILY: 1q7fA
Sequence length 286
Comment (A:)
Sequence
gthmksqikrqrmiyhckfgefgvmegqftepsgvavnaqndiivadtnnhriqifdkeg
rfkfqfgecgkrdsqllypnrvavvrnsgdiivterspthqiqiynqygqfvrkfgatil
qhprgvtvdnkgriivveckvmrviifdqngnvlhkfgcskhlefpngvvvndkqeifis
dnrahcvkvfnyegqylrqiggegitnypigvginsngeiliadnhnnfnltiftqdgql
isaleskvkhaqcfdvalmddgsvvlaskdyrlyiyryvqlapvgm
Download sequence
Identical sequences 1q7f_A 1q7f_B 1q7fA cath|current|1q7fA00/759-1037 cath|current|1q7fB00/756-1037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]