SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qg7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qg7A
Domain Number 1 Region: 8-67
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 3.3e-20
Family Interleukin 8-like chemokines 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qg7A   PDB: 1qg7   SUPERFAMILY: 1qg7A
Sequence length 67
Comment (A:)
Sequence
kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekaln
Download sequence
Identical sequences 1qg7_A 1qg7_B 1sdf_A 2sdf_A 000000664|e2j7zA1|1170.1.1.1|A:1-67 000026822|e1sdfA1|1170.1.1.1|A:1-67 000026823|e2sdfA1|1170.1.1.1|A:1-67 000026824|e2j7zB1|1170.1.1.1|B:1-67 cath|current|1qg7A00/6-67 cath|current|1qg7B00/2-67 cath|current|1sdfA00/1-67 cath|current|2sdfA00/1-67 d1sdfa_ d2sdfa_ 1qg7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]