SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1qlbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qlbA
Domain Number 1 Region: 458-654
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.15e-58
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000000334
Further Details:      
 
Domain Number 2 Region: 4-116,145-274,374-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-56
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000000594
Further Details:      
 
Domain Number 3 Region: 251-370
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.61e-37
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qlbA   PDB: 1qlb
Sequence length 656
Comment (A:)
Sequence
mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
frdgphleksvkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapryrgygak
gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
Download sequence
Identical sequences 1qlb_A 1qlb_D 1qlbA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]