SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1qo0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qo0A
Domain Number 1 Region: 10-375
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.81e-89
Family L-arabinose binding protein-like 0.00000000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qo0A   PDB: 1qo0   SUPERFAMILY: 1qo0A
Sequence length 385
Comment (A:)
Sequence
mgshqerpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdp
dryrlcaedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyg
gpapnqnsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiply
psdddlqraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaeva
kmesdvaegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraa
qaagnwrvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspep
irpdpyvvvhnlddwsasmgggplp
Download sequence
Identical sequences 1qo0A 1pea_A 1qo0_A 1qo0_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]