SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1r6tA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1r6tA
Domain Number 1 Region: 82-464
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.37e-131
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000542
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000000106
Family a tRNA synthase domain 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1r6tA   PDB: 1r6t
Sequence length 477
Comment (A:)
Sequence
mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
kwlqdvfnvplviqmtddekylwkdltldqaygdavenakdiiacgfdinktfifsdldy
mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklaaalehhhhhh
Download sequence
Identical sequences 1r6t_A 1r6t_B 1r6tA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]