SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1reoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1reoA
Domain Number 1 Region: 32-339,445-482
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.16e-64
Family FAD-linked reductases, N-terminal domain 0.0000000000567
Further Details:      
 
Domain Number 2 Region: 320-430
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.03e-31
Family L-aminoacid/polyamine oxidase 0.000000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1reoA   PDB: 1reo
Sequence length 486
Comment (A:)
Sequence
andrnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvt
vleaseraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnaw
yfiknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnky
dtystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggm
dklptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratr
rikfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnh
nftsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkw
sldkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardv
nraseq
Download sequence
Identical sequences 1reoA 1reo_A 1tdk_A 1tdn_A 1tdo_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]