SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rj6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rj6A
Domain Number 1 Region: 4-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.53e-130
Family Carbonic anhydrase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rj6A   PDB: 1rj6   SUPERFAMILY: 1rj6A
Sequence length 261
Comment (A:)
Sequence
gghhwtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepl
dlhnnghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvv
hydsqsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfs
vrelfpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpse
plvqnyrvpqplnqrtifasf
Download sequence
Identical sequences 1rj6A 1rj5_A 1rj5_B 1rj6_A 1rj6_B cath|current|1rj5A00/3-260 cath|current|1rj5B00/5-260 cath|current|1rj6A00/3-260 cath|current|1rj6B00/5-260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]