SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rm1B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rm1B
Domain Number 1 Region: 55-119
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.61e-24
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 2.93e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rm1B   PDB: 1rm1
Sequence length 122
Comment (B:)
Sequence
MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKL
TVKGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKK
SE
Download sequence
Identical sequences A0A0L8VM13 A0A250WJ13 A6ZZQ8 B3LR33 C7GP16 C8ZCB4 E7KEY0 E7KR26 G2WHX4 H0GJ75 N1P094 P32774
YKL058W YKL058W YKL058W YKL058W YKL058W YKL058W YKL058W YKL058W NP_012865.1.97178 YKL058W 1rm1B YKL058W YKL058W YKL058W tr|A6ZZQ8|A6ZZQ8_YEAS7 YKL058W YKL058W YT79 YKL058W YKL058W YKL058W YKL058W 1rm1_B 5fmf_O 5fyw_V 5fz5_V 5oqj_V 5oqm_V 5sva_e YKL058w___KOG3463 YKL058W SCRT_03963 YKL058W YKL058W 4932.YKL058W YKL058W YKL058W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]