SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rrpB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rrpB
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-79
Family Ran-binding domain 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rrpB   PDB: 1rrp   SUPERFAMILY: 1rrpB
Sequence length 134
Comment (B:)
Sequence
hfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsgki
rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpee
aalfkckfeeaqsi
Download sequence
Identical sequences 1rrp_B 1rrp_D 1rrpB 000028895|e1rrpD1|220.1.1.23|D:1-134 000028896|e1rrpB1|220.1.1.23|B:1-134 cath|current|1rrpB00/17-150 cath|current|1rrpD00/17-150 d1rrpb_ d1rrpd_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]