SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rwiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rwiA
Domain Number 1 Region: 21-260
Classification Level Classification E-value
Superfamily NHL repeat 1.35e-48
Family NHL repeat 0.000000000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rwiA   PDB: 1rwi   SUPERFAMILY: 1rwiA
Sequence length 270
Comment (A:)
Sequence
rpswsptqasgqtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklatgstgttv
lpfnglyqpqglavdgagtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqga
vyvadrgnnrvvklaagsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaes
nnqvvlpftditapwgiavdeagtvyvtehntnqvvkllagsttstvlpftglntplava
vdsdrtvyvadrgndrvvkltslehhhhhh
Download sequence
Identical sequences cath|current|1rwiA00/11-270 cath|current|1rwiB00/12-270 cath|current|1rwlA00/11-268 1rwi_A 1rwi_B 1rwl_A 1rwiA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]