SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ryiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ryiA
Domain Number 1 Region: 17-232,319-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.9e-45
Family FAD-linked reductases, N-terminal domain 0.000000000523
Further Details:      
 
Domain Number 2 Region: 233-318
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.05e-21
Family D-aminoacid oxidase-like 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ryiA   PDB: 1ryi
Sequence length 382
Comment (A:)
Sequence
mhhhhhhmariramkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaa
gmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlq
lrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgae
ifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgecl
svwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlp
aiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlim
nkevnqdwlhafridrkeavni
Download sequence
Identical sequences 1ryiA 1ryi_A 1ryi_B 1ryi_C 1ryi_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]