SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1sezA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sezA
Domain Number 1 Region: 13-345,456-493
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.13e-48
Family FAD-linked reductases, N-terminal domain 0.0000000000217
Further Details:      
 
Domain Number 2 Region: 330-440
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.26e-32
Family L-aminoacid/polyamine oxidase 0.000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sezA   PDB: 1sez
Sequence length 504
Comment (A:)
Sequence
MAPSAGEDKHSSAKRVAVIGAGVSGLAAAYKLKIHGLNVTVFEAEGKAGGKLRSVSQDGL
IWDEGANTMTESEGDVTFLIDSLGLREKQQFPLSQNKRYIARNGTPVLLPSNPIDLIKSN
FLSTGSKLQMLLEPILWKNKKLSQVSDSHESVSGFFQRHFGKEVVDYLIDPFVAGTCGGD
PDSLSMHHSFPELWNLEKRFGSVILGAIRSKLSPKNEKKQGPPKTSANKKRQRGSFSFLG
GMQTLTDAICKDLREDELRLNSRVLELSCSCTEDSAIDSWSIISASPHKRQSEEESFDAV
IMTAPLCDVKSMKIAKRGNPFLLNFIPEVDYVPLSVVITTFKRENVKYPLEGFGVLVPSK
EQQHGLKTLGTLFSSMMFPDRAPNNVYLYTTFVGGSRNRELAKASRTELKEIVTSDLKQL
LGAEGEPTYVNHLYWSKAFPLYGHNYDSVLDAIDKMEKNLPGLFYAGNHRGGLSVGKALS
SGCNAADLVISYLESVSTDSKRHC
Download sequence
Identical sequences A0A1U7XRL0 O24164
1sez_A 1sez_B XP_009792271.1.57364 XP_009792272.1.57364 1sezA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]