SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1tdfA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tdfA
Domain Number 1 Region: 3-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.93e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tdfA   PDB: 1tdf
Sequence length 316
Comment (A:)
Sequence
gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
lpseeafkgrgvsacatsdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
tgcmaaldaeryldgl
Download sequence
Identical sequences 1tdf_A 1tdfA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]