SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1th8B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1th8B
Domain Number 1 Region: 4-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.53e-32
Family Anti-sigma factor antagonist SpoIIaa 0.00000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1th8B   PDB: 1th8   SUPERFAMILY: 1th8B
Sequence length 116
Comment (B:)
Sequence
MSLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDSSG
LGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGVA
Download sequence
Identical sequences A0A063YTV1 A0A0D8BXP3 A0A0E0TE19 A0A0K2HCH5 A0A0K9HS05 A0A0Q1CKZ4 A0A142D228 A0A1C3D2E5 A0A1Q5SRL9 A0A1V4PB17 A0A1V9CUA6 L7ZTR5 Q5KXJ1
gi|297529522|ref|YP_003670797.1| gi|448238601|ref|YP_007402659.1| gi|319767334|ref|YP_004132835.1| 235909.GK2310 544556.GYMC61_0372 gi|56420845|ref|YP_148163.1| cath|current|1th8B00/2-116 cath|current|1thnB00/2-115 cath|current|1thnD00/2-116 gi|261417854|ref|YP_003251536.1| 1th8_B 1thn_B 1thn_D 1th8B WP_011231792.1.13089 WP_011231792.1.17728 WP_011231792.1.19233 WP_011231792.1.20351 WP_011231792.1.20723 WP_011231792.1.2219 WP_011231792.1.22479 WP_011231792.1.24107 WP_011231792.1.30801 WP_011231792.1.3446 WP_011231792.1.38260 WP_011231792.1.38928 WP_011231792.1.43576 WP_011231792.1.44827 WP_011231792.1.46340 WP_011231792.1.46681 WP_011231792.1.50933 WP_011231792.1.54348 WP_011231792.1.56669 WP_011231792.1.58461 WP_011231792.1.59104 WP_011231792.1.72400 WP_011231792.1.77642 WP_011231792.1.80994 WP_011231792.1.92435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]