SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1tidB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tidB
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.31e-31
Family Anti-sigma factor antagonist SpoIIaa 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tidB   PDB: 1tid   SUPERFAMILY: 1tidB
Sequence length 119
Comment (B:)
Sequence
gshmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmd
asglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
Download sequence
Identical sequences cath|current|1tilB00/0-116 cath|current|1tilD00/-1-116 cath|current|1tilF00/0-116 1tid_B 1tid_D 1til_B 1til_D 1til_F 1tidB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]