SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1tjlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tjlA
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 1.1e-37
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00000134
Further Details:      
 
Domain Number 2 Region: 111-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000539
Family Prokaryotic DksA/TraR C4-type zinc finger 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tjlA   PDB: 1tjl
Sequence length 151
Comment (A:)
Sequence
MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRNQLRDEVDRTVT
HMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDFGYCESCGVE
IGIRRLEARPTADLCIDCKTLAEIREKQMAG
Download sequence
Identical sequences A0A017IPC6 A0A023YSC0 A0A024KKF0 A0A025CN49 A0A026V736 A0A027U2I2 A0A027ZXL4 A0A028E8X7 A0A029ICZ8 A0A029J278 A0A062YHV4 A0A064U1Z4 A0A069XN35 A0A070F8S2 A0A070SPK8 A0A070UCL4 A0A073G192 A0A073HT47 A0A073UJF4 A0A074IB70 A0A080GC39 A0A080JFJ9 A0A0A0F6T6 A0A0A8U7R1 A0A0E0TTU5 A0A0E0V0A3 A0A0E0Y7A7 A0A0E1LTI1 A0A0E1SS74 A0A0E2LPE5 A0A0E2TK26 A0A0F6BYZ1 A0A0F6F0X7 A0A0F6MA37 A0A0F6VPF5 A0A0G3K0R9 A0A0G3QCR7 A0A0H3EF29 A0A0H3MLW4 A0A0H3PKD3 A0A0I1DQH8 A0A0K9TJG5 A0A0M7N0V2 A0A0S3MSB4 A0A0U4HPW5 A0A125X8J3 A0A127GGC8 A0A140NDZ7 A0A142GZ96 A0A181WTP0 A0A1B7JM59 A0A1C2WTL9 A0A1E2VNZ2 A0A1E3MXX7 A0A1I1VPH5 A0A1Q8M285 A0A1Q8N8E4 A0A1S6T6F4 A0A1U6ID51 A0A1X3IGJ2 A0A1X3L9B7 A0A1X3M374 A0A1X3MEX7 A0A1Z3UUU8 A0A222QFQ1 A0A226K566 A0A2D0NLQ1 A0A2H1BPJ5 A0A2I8C5I8 A0A2I8P6V5 A0A2I8Q9I8 A0A2I8QGG7 A7MGQ8 A7ZHN6 B1EMC4 B1LGU7 B2U2Y9 B3X236 B6HZC0 B7LGK7 B7LW52 B7MBC8 B7MP07 B7N814 B7UII9 C3TPZ2 C8U1L5 C8UH13 C9XW81 D2AIS5 D3GR92 D3QWE7 D7XDS8 D7XR88 D7Y737 D7ZKC3 D8AA38 D8EF85 E0IYN6 E1ITM9 E1J614 E2XCP1 E3PCJ5 E3XLL6 E6BLF2 E7SDC4 E7SZM8 E7T9I5 E9TIB2 E9XQI2 E9YYU0 F0JQT1 F3V1D2 F3WDU7 F5MXB8 F5NPL4 G0FA89 G9YZM2 H4I6H0 H4IM19 H4J3G6 H4KC77 H4L7G2 H4UE20 I0VYZ0 I2RPQ1 I2RTM4 I2SL40 I2UQQ1 I2W648 I2WR87 I2X8S8 I4T647 I6C516 I6D6W5 I6DVI6 I6EWE4 I6G9C3 I6HAG2 J7RC87 K0X0P7 K4W5K7 K8A263 K8BH28 K8C749 K8CJU5 K8DLX2 L2VB49 L2VK44 L2XXD5 L3BVF3 L3PFS5 L3Q3H5 L3QHG9 L4JGY1 L4W6Z3 M9HA12 P0ABS1 P0ABS2 P0ABS3 P0ABS4 Q0T861 Q325Z4 Q32JW2 Q3Z5L2 Q548M3 R8XEV1 S0TS88 S0W0C0 S0XAD7 S0YCM8 S0ZVQ3 S1CE06 S1CW97 S1E0V2 S1FYV1 S1HLI6 S1I8Y1 S1JAL4 S1KTL7 S1NXF3 T5VRQ4 T6B1W8 T6I2A2 T6MCC4 T8JK62 T9BE06 T9DL17 T9UM43 U9XQD2 U9XR75 U9YTX0 U9ZJ22 U9ZZ43 V0SE89 V0VQC5 V0X634 V0YEW4 V2Q706 V2TZD1 V6G3H6 V8FPE8 V8K8L6 W0AP54 W1BK87 W1F5W1 W1XFL5
gi|162138499|ref|YP_539200.2| gi|15829403|ref|NP_308176.1| gi|251783705|ref|YP_002998009.1| gi|209917336|ref|YP_002291420.1| gi|386617650|ref|YP_006137230.1| gi|218688022|ref|YP_002396234.1| gi|16128138|ref|NP_414687.1| gi|253774827|ref|YP_003037658.1| gi|251783705|ref|YP_002998009.1| gi|378714515|ref|YP_005279408.1| gi|218552726|ref|YP_002385639.1| gi|386622558|ref|YP_006142286.1| gi|388476264|ref|YP_488448.1| gi|384541717|ref|YP_005725778.1| gi|386707874|ref|YP_006171595.1| gi|218698566|ref|YP_002406195.1| gi|387828211|ref|YP_003348148.1| gi|410484223|ref|YP_006771769.1| gi|387610618|ref|YP_006113734.1| gi|260596568|ref|YP_003209139.1| gi|386707874|ref|YP_006171595.1| gi|156935337|ref|YP_001439253.1| gi|544388994|ref|YP_008563294.1| gi|170679800|ref|YP_001742273.1| gi|386703344|ref|YP_006167191.1| gi|471332371|ref|YP_007555848.1| gi|449309463|ref|YP_007441819.1| gi|387605622|ref|YP_006094478.1| gi|170079782|ref|YP_001729102.1| gi|407467601|ref|YP_006785957.1| gi|187733763|ref|YP_001878948.1| gi|215485305|ref|YP_002327736.1| APC27204 NYSGXRC-T497 eco001000138.1 gi|74310766|ref|YP_309185.1| gi|383176750|ref|YP_005454755.1| gi|56479612|ref|NP_706093.2| gi|238899544|ref|YP_002925340.1| gi|387619913|ref|YP_006127540.1| gi|387505074|ref|YP_006157330.1| 155864.Z0156 198214.SF0137 198215.S0140 199310.c0178 290339.ESA_03195 300267.SDY_0161 300268.SBO_0134 300269.SSON_0157 316385.ECDH10B_0125 316407.dksA 331111.EcE24377A_0149 331112.EcHS_A0148 344609.SbBS512_E0136 362663.ECP_0155 364106.UTI89_C0159 373384.SFV_0130 386585.ECs0149 409438.ECSE_0145 413502.Ctu_07760 413997.ECB_00144 439855.EcSMS35_0156 444450.ECH74115_0154 469008.ECBD_3474 481805.EcolC_3514 511145.b0145 544404.ECSP_0146 573235.ECO26_0148 574521.E2348C_0148 585034.ECIAI1_0143 585035.ECS88_0155 585054.EFER_0168 585055.EC55989_0139 585056.ECUMN_0142 585057.ECIAI39_0149 585395.ECO103_0145 585396.ECO111_0147 585397.ECED1_0150 595496.BWG_0138 gi|260853356|ref|YP_003227247.1| gi|218693611|ref|YP_002401278.1| gi|260866295|ref|YP_003232697.1| gi|291280969|ref|YP_003497787.1| gi|544574572|ref|YP_008570096.1| gi|254791280|ref|YP_003076117.1| 1tjlA gi|218557088|ref|YP_002390001.1| gi|386597896|ref|YP_006099402.1| gi|389842183|ref|YP_006344267.1| gi|254160265|ref|YP_003043373.1| gi|218703401|ref|YP_002410920.1| gi|82775537|ref|YP_401884.1| gi|222154973|ref|YP_002555112.1| gi|30061705|ref|NP_835876.1| gi|209399928|ref|YP_002268754.1| gi|443616158|ref|YP_007380014.1| gi|157158209|ref|YP_001461315.1| NP_308176.1.58667 NP_414687.1.90541 NP_706093.2.23235 WP_001155227.1.1000 WP_001155227.1.10001 WP_001155227.1.100014 WP_001155227.1.100044 WP_001155227.1.100052 WP_001155227.1.100063 WP_001155227.1.100066 WP_001155227.1.100073 WP_001155227.1.100085 WP_001155227.1.10010 WP_001155227.1.100111 WP_001155227.1.100116 WP_001155227.1.100123 WP_001155227.1.100135 WP_001155227.1.100138 WP_001155227.1.100151 WP_001155227.1.100159 WP_001155227.1.100185 WP_001155227.1.100194 WP_001155227.1.100220 WP_001155227.1.100227 WP_001155227.1.100251 WP_001155227.1.100252 WP_001155227.1.100281 WP_001155227.1.100283 WP_001155227.1.100285 WP_001155227.1.100299 WP_001155227.1.100302 WP_001155227.1.100304 WP_001155227.1.100315 WP_001155227.1.100327 WP_001155227.1.10034 WP_001155227.1.100346 WP_001155227.1.100389 WP_001155227.1.100425 WP_001155227.1.100441 WP_001155227.1.100444 WP_001155227.1.100447 WP_001155227.1.100448 WP_001155227.1.100451 WP_001155227.1.100474 WP_001155227.1.10048 WP_001155227.1.100487 WP_001155227.1.100496 WP_001155227.1.100499 WP_001155227.1.100508 WP_001155227.1.10051 WP_001155227.1.100531 WP_001155227.1.100543 WP_001155227.1.100554 WP_001155227.1.100571 WP_001155227.1.100573 WP_001155227.1.100614 WP_001155227.1.100667 WP_001155227.1.10067 WP_001155227.1.10068 WP_001155227.1.100685 WP_001155227.1.100688 WP_001155227.1.100689 WP_001155227.1.100718 WP_001155227.1.100725 WP_001155227.1.100735 WP_001155227.1.100738 WP_001155227.1.100752 WP_001155227.1.100753 WP_001155227.1.100758 WP_001155227.1.100778 WP_001155227.1.100796 WP_001155227.1.10080 WP_001155227.1.100803 WP_001155227.1.100824 WP_001155227.1.100836 WP_001155227.1.100851 WP_001155227.1.100852 WP_001155227.1.10086 WP_001155227.1.100867 WP_001155227.1.100868 WP_001155227.1.100898 WP_001155227.1.100916 WP_001155227.1.100925 WP_001155227.1.100928 WP_001155227.1.100933 WP_001155227.1.10094 WP_001155227.1.100950 WP_001155227.1.100959 WP_001155227.1.100966 WP_001155227.1.100990 WP_001155227.1.10100 WP_001155227.1.101033 WP_001155227.1.101052 WP_001155227.1.101087 WP_001155227.1.101096 WP_001155227.1.1011 WP_001155227.1.101102 WP_001155227.1.101105 WP_001155227.1.101110 WP_001155227.1.101121 WP_001155227.1.101148 WP_001155227.1.101152 WP_001155227.1.101157 WP_001155227.1.101158 WP_001155227.1.101166 WP_001155227.1.101175 WP_001155227.1.101186 WP_001155227.1.101206 WP_001155227.1.101214 WP_001155227.1.101216 WP_001155227.1.101255 WP_001155227.1.101257 WP_001155227.1.10126 WP_001155227.1.101282 WP_001155227.1.101289 WP_001155227.1.101293 WP_001155227.1.10131 WP_001155227.1.101313 WP_001155227.1.101359 WP_001155227.1.10138 WP_001155227.1.101387 WP_001155227.1.101399 WP_001155227.1.101418 WP_001155227.1.101423 WP_001155227.1.101429 WP_001155227.1.101430 WP_001155227.1.101436 WP_001155227.1.101439 WP_001155227.1.101445 WP_001155227.1.101468 WP_001155227.1.101486 WP_001155227.1.101518 WP_001155227.1.101522 WP_001155227.1.10154 WP_001155227.1.101545 WP_001155227.1.101583 WP_001155227.1.101586 WP_001155227.1.101594 WP_001155227.1.101628 WP_001155227.1.101630 WP_001155227.1.101651 WP_001155227.1.101653 WP_001155227.1.101654 WP_001155227.1.101667 WP_001155227.1.101668 WP_001155227.1.101686 WP_001155227.1.101693 WP_001155227.1.101694 WP_001155227.1.101700 WP_001155227.1.101727 WP_001155227.1.10173 WP_001155227.1.101737 WP_001155227.1.101747 WP_001155227.1.101769 WP_001155227.1.101777 WP_001155227.1.101786 WP_001155227.1.10181 WP_001155227.1.101822 WP_001155227.1.10184 WP_001155227.1.101840 WP_001155227.1.101845 WP_001155227.1.101855 WP_001155227.1.101865 WP_001155227.1.10187 WP_001155227.1.10188 WP_001155227.1.101887 WP_001155227.1.101889 WP_001155227.1.10190 WP_001155227.1.101900 WP_001155227.1.101908 WP_001155227.1.101913 WP_001155227.1.101926 WP_001155227.1.101932 WP_001155227.1.101935 WP_001155227.1.101937 WP_001155227.1.101940 WP_001155227.1.101942 WP_001155227.1.101947 WP_001155227.1.101948 WP_001155227.1.101952 WP_001155227.1.101962 WP_001155227.1.101964 WP_001155227.1.101969 WP_001155227.1.101977 WP_001155227.1.101984 WP_001155227.1.101987 WP_001155227.1.102021 WP_001155227.1.102036 WP_001155227.1.10206 WP_001155227.1.102069 WP_001155227.1.102076 WP_001155227.1.102093 WP_001155227.1.102094 WP_001155227.1.102104 WP_001155227.1.102106 WP_001155227.1.102122 WP_001155227.1.102139 WP_001155227.1.102144 WP_001155227.1.10222 WP_001155227.1.10226 WP_001155227.1.10233 WP_001155227.1.10235 WP_001155227.1.10252 WP_001155227.1.10273 WP_001155227.1.10304 WP_001155227.1.10326 WP_001155227.1.10329 WP_001155227.1.10335 WP_001155227.1.10348 WP_001155227.1.10352 WP_001155227.1.10361 WP_001155227.1.10379 WP_001155227.1.10381 WP_001155227.1.1040 WP_001155227.1.10400 WP_001155227.1.10417 WP_001155227.1.10461 WP_001155227.1.10476 WP_001155227.1.10491 WP_001155227.1.10492 WP_001155227.1.10496 WP_001155227.1.10508 WP_001155227.1.10524 WP_001155227.1.10525 WP_001155227.1.10538 WP_001155227.1.10569 WP_001155227.1.10573 WP_001155227.1.10576 WP_001155227.1.10579 WP_001155227.1.1058 WP_001155227.1.10605 WP_001155227.1.10607 WP_001155227.1.10628 WP_001155227.1.10651 WP_001155227.1.10673 WP_001155227.1.10697 WP_001155227.1.10705 WP_001155227.1.1071 WP_001155227.1.10715 WP_001155227.1.10729 WP_001155227.1.1073 WP_001155227.1.1074 WP_001155227.1.10743 WP_001155227.1.10744 WP_001155227.1.10748 WP_001155227.1.10761 WP_001155227.1.10763 WP_001155227.1.10771 WP_001155227.1.10786 WP_001155227.1.10787 WP_001155227.1.10798 WP_001155227.1.10809 WP_001155227.1.10814 WP_001155227.1.10824 WP_001155227.1.10833 WP_001155227.1.10842 WP_001155227.1.10849 WP_001155227.1.10862 WP_001155227.1.10869 WP_001155227.1.10922 WP_001155227.1.10940 WP_001155227.1.10970 WP_001155227.1.10988 WP_001155227.1.10989 WP_001155227.1.10994 WP_001155227.1.10995 WP_001155227.1.11006 WP_001155227.1.11032 WP_001155227.1.11047 WP_001155227.1.11052 WP_001155227.1.11057 WP_001155227.1.11068 WP_001155227.1.11071 WP_001155227.1.11091 WP_001155227.1.1111 WP_001155227.1.11113 WP_001155227.1.11118 WP_001155227.1.11121 WP_001155227.1.1113 WP_001155227.1.11133 WP_001155227.1.112 WP_001155227.1.11201 WP_001155227.1.11217 WP_001155227.1.1122 WP_001155227.1.11240 WP_001155227.1.11241 WP_001155227.1.11250 WP_001155227.1.11251 WP_001155227.1.11265 WP_001155227.1.11272 WP_001155227.1.11285 WP_001155227.1.11296 WP_001155227.1.11301 WP_001155227.1.11315 WP_001155227.1.11323 WP_001155227.1.11399 WP_001155227.1.11408 WP_001155227.1.1141 WP_001155227.1.11411 WP_001155227.1.11418 WP_001155227.1.11420 WP_001155227.1.11436 WP_001155227.1.11437 WP_001155227.1.11440 WP_001155227.1.11452 WP_001155227.1.11467 WP_001155227.1.11499 WP_001155227.1.11519 WP_001155227.1.11524 WP_001155227.1.11531 WP_001155227.1.11542 WP_001155227.1.11575 WP_001155227.1.11578 WP_001155227.1.11595 WP_001155227.1.11607 WP_001155227.1.11608 WP_001155227.1.11612 WP_001155227.1.11616 WP_001155227.1.11645 WP_001155227.1.11671 WP_001155227.1.11673 WP_001155227.1.1168 WP_001155227.1.11690 WP_001155227.1.11699 WP_001155227.1.11729 WP_001155227.1.11748 WP_001155227.1.11759 WP_001155227.1.1176 WP_001155227.1.11762 WP_001155227.1.11801 WP_001155227.1.11803 WP_001155227.1.11844 WP_001155227.1.1186 WP_001155227.1.11912 WP_001155227.1.11948 WP_001155227.1.11949 WP_001155227.1.11955 WP_001155227.1.11956 WP_001155227.1.1196 WP_001155227.1.11981 WP_001155227.1.11982 WP_001155227.1.11985 WP_001155227.1.12000 WP_001155227.1.12009 WP_001155227.1.12010 WP_001155227.1.12030 WP_001155227.1.12036 WP_001155227.1.12050 WP_001155227.1.12051 WP_001155227.1.12060 WP_001155227.1.12076 WP_001155227.1.12088 WP_001155227.1.12095 WP_001155227.1.12111 WP_001155227.1.12112 WP_001155227.1.1212 WP_001155227.1.12151 WP_001155227.1.12157 WP_001155227.1.12174 WP_001155227.1.1218 WP_001155227.1.12204 WP_001155227.1.12230 WP_001155227.1.12259 WP_001155227.1.12268 WP_001155227.1.12279 WP_001155227.1.12292 WP_001155227.1.12295 WP_001155227.1.12305 WP_001155227.1.12320 WP_001155227.1.12342 WP_001155227.1.12344 WP_001155227.1.12352 WP_001155227.1.12415 WP_001155227.1.1242 WP_001155227.1.12426 WP_001155227.1.12458 WP_001155227.1.12459 WP_001155227.1.12468 WP_001155227.1.12478 WP_001155227.1.12542 WP_001155227.1.12552 WP_001155227.1.12558 WP_001155227.1.12566 WP_001155227.1.12574 WP_001155227.1.12582 WP_001155227.1.12594 WP_001155227.1.12623 WP_001155227.1.12645 WP_001155227.1.12646 WP_001155227.1.12675 WP_001155227.1.12679 WP_001155227.1.12693 WP_001155227.1.12697 WP_001155227.1.127 WP_001155227.1.12709 WP_001155227.1.12717 WP_001155227.1.12743 WP_001155227.1.12749 WP_001155227.1.1275 WP_001155227.1.12756 WP_001155227.1.12761 WP_001155227.1.12762 WP_001155227.1.12763 WP_001155227.1.12766 WP_001155227.1.12775 WP_001155227.1.1278 WP_001155227.1.12781 WP_001155227.1.1280 WP_001155227.1.12826 WP_001155227.1.12830 WP_001155227.1.12831 WP_001155227.1.12876 WP_001155227.1.12893 WP_001155227.1.12911 WP_001155227.1.12914 WP_001155227.1.12915 WP_001155227.1.12917 WP_001155227.1.12944 WP_001155227.1.1295 WP_001155227.1.12956 WP_001155227.1.12965 WP_001155227.1.12976 WP_001155227.1.12979 WP_001155227.1.12987 WP_001155227.1.12991 WP_001155227.1.13002 WP_001155227.1.13015 WP_001155227.1.13031 WP_001155227.1.13060 WP_001155227.1.13074 WP_001155227.1.1308 WP_001155227.1.13117 WP_001155227.1.1312 WP_001155227.1.13136 WP_001155227.1.1314 WP_001155227.1.13144 WP_001155227.1.1315 WP_001155227.1.13157 WP_001155227.1.13162 WP_001155227.1.13176 WP_001155227.1.13181 WP_001155227.1.13205 WP_001155227.1.13217 WP_001155227.1.13222 WP_001155227.1.13223 WP_001155227.1.1323 WP_001155227.1.13239 WP_001155227.1.13252 WP_001155227.1.13258 WP_001155227.1.13271 WP_001155227.1.13272 WP_001155227.1.13278 WP_001155227.1.13281 WP_001155227.1.13290 WP_001155227.1.13295 WP_001155227.1.13301 WP_001155227.1.13332 WP_001155227.1.13333 WP_001155227.1.13346 WP_001155227.1.13348 WP_001155227.1.1335 WP_001155227.1.13383 WP_001155227.1.13393 WP_001155227.1.13409 WP_001155227.1.13411 WP_001155227.1.1343 WP_001155227.1.13430 WP_001155227.1.13437 WP_001155227.1.13442 WP_001155227.1.1345 WP_001155227.1.13451 WP_001155227.1.13473 WP_001155227.1.13481 WP_001155227.1.13492 WP_001155227.1.13495 WP_001155227.1.13525 WP_001155227.1.13566 WP_001155227.1.13585 WP_001155227.1.13589 WP_001155227.1.13600 WP_001155227.1.13601 WP_001155227.1.13608 WP_001155227.1.13618 WP_001155227.1.13624 WP_001155227.1.13626 WP_001155227.1.13644 WP_001155227.1.13656 WP_001155227.1.13662 WP_001155227.1.13664 WP_001155227.1.13672 WP_001155227.1.13740 WP_001155227.1.13778 WP_001155227.1.13791 WP_001155227.1.13798 WP_001155227.1.13824 WP_001155227.1.13867 WP_001155227.1.13877 WP_001155227.1.13881 WP_001155227.1.13891 WP_001155227.1.13924 WP_001155227.1.13934 WP_001155227.1.13936 WP_001155227.1.13939 WP_001155227.1.13944 WP_001155227.1.13949 WP_001155227.1.13974 WP_001155227.1.13979 WP_001155227.1.13981 WP_001155227.1.14023 WP_001155227.1.14030 WP_001155227.1.14042 WP_001155227.1.14058 WP_001155227.1.14062 WP_001155227.1.14070 WP_001155227.1.14094 WP_001155227.1.14110 WP_001155227.1.14127 WP_001155227.1.14129 WP_001155227.1.14144 WP_001155227.1.14164 WP_001155227.1.1419 WP_001155227.1.14199 WP_001155227.1.142 WP_001155227.1.14245 WP_001155227.1.14253 WP_001155227.1.14277 WP_001155227.1.14292 WP_001155227.1.14299 WP_001155227.1.14304 WP_001155227.1.14322 WP_001155227.1.14331 WP_001155227.1.14346 WP_001155227.1.14371 WP_001155227.1.1438 WP_001155227.1.14389 WP_001155227.1.1439 WP_001155227.1.14398 WP_001155227.1.14417 WP_001155227.1.14432 WP_001155227.1.14445 WP_001155227.1.14450 WP_001155227.1.14451 WP_001155227.1.14453 WP_001155227.1.14468 WP_001155227.1.14471 WP_001155227.1.14493 WP_001155227.1.14499 WP_001155227.1.14501 WP_001155227.1.14506 WP_001155227.1.14508 WP_001155227.1.14509 WP_001155227.1.14529 WP_001155227.1.14536 WP_001155227.1.14538 WP_001155227.1.14581 WP_001155227.1.14582 WP_001155227.1.14600 WP_001155227.1.14601 WP_001155227.1.14605 WP_001155227.1.14607 WP_001155227.1.1461 WP_001155227.1.14616 WP_001155227.1.14621 WP_001155227.1.14648 WP_001155227.1.14661 WP_001155227.1.14672 WP_001155227.1.14678 WP_001155227.1.14687 WP_001155227.1.14693 WP_001155227.1.1470 WP_001155227.1.14711 WP_001155227.1.14712 WP_001155227.1.14746 WP_001155227.1.14748 WP_001155227.1.14749 WP_001155227.1.14807 WP_001155227.1.14811 WP_001155227.1.14833 WP_001155227.1.1486 WP_001155227.1.14861 WP_001155227.1.14871 WP_001155227.1.14879 WP_001155227.1.14914 WP_001155227.1.14934 WP_001155227.1.14935 WP_001155227.1.14946 WP_001155227.1.14956 WP_001155227.1.14958 WP_001155227.1.14963 WP_001155227.1.14965 WP_001155227.1.14977 WP_001155227.1.14992 WP_001155227.1.14993 WP_001155227.1.15007 WP_001155227.1.15020 WP_001155227.1.15041 WP_001155227.1.15068 WP_001155227.1.1508 WP_001155227.1.15087 WP_001155227.1.15090 WP_001155227.1.1510 WP_001155227.1.15117 WP_001155227.1.1512 WP_001155227.1.15121 WP_001155227.1.15138 WP_001155227.1.15148 WP_001155227.1.15177 WP_001155227.1.15191 WP_001155227.1.15193 WP_001155227.1.15207 WP_001155227.1.15221 WP_001155227.1.1524 WP_001155227.1.15245 WP_001155227.1.15252 WP_001155227.1.15259 WP_001155227.1.15270 WP_001155227.1.15274 WP_001155227.1.15277 WP_001155227.1.15282 WP_001155227.1.15287 WP_001155227.1.15290 WP_001155227.1.153 WP_001155227.1.15300 WP_001155227.1.15304 WP_001155227.1.15332 WP_001155227.1.15335 WP_001155227.1.15347 WP_001155227.1.15356 WP_001155227.1.15377 WP_001155227.1.15416 WP_001155227.1.15420 WP_001155227.1.1543 WP_001155227.1.15444 WP_001155227.1.15453 WP_001155227.1.15464 WP_001155227.1.15469 WP_001155227.1.15496 WP_001155227.1.1550 WP_001155227.1.15503 WP_001155227.1.15521 WP_001155227.1.15527 WP_001155227.1.15528 WP_001155227.1.15538 WP_001155227.1.15565 WP_001155227.1.15576 WP_001155227.1.15583 WP_001155227.1.1559 WP_001155227.1.15593 WP_001155227.1.15600 WP_001155227.1.1561 WP_001155227.1.15620 WP_001155227.1.15624 WP_001155227.1.15626 WP_001155227.1.15645 WP_001155227.1.15654 WP_001155227.1.15702 WP_001155227.1.15707 WP_001155227.1.15731 WP_001155227.1.15740 WP_001155227.1.15747 WP_001155227.1.15752 WP_001155227.1.15762 WP_001155227.1.15767 WP_001155227.1.15768 WP_001155227.1.15771 WP_001155227.1.15782 WP_001155227.1.15791 WP_001155227.1.1580 WP_001155227.1.15809 WP_001155227.1.1582 WP_001155227.1.15855 WP_001155227.1.15857 WP_001155227.1.15863 WP_001155227.1.15869 WP_001155227.1.1588 WP_001155227.1.15880 WP_001155227.1.15894 WP_001155227.1.15906 WP_001155227.1.15916 WP_001155227.1.15945 WP_001155227.1.15949 WP_001155227.1.15951 WP_001155227.1.15983 WP_001155227.1.15984 WP_001155227.1.15990 WP_001155227.1.16010 WP_001155227.1.16014 WP_001155227.1.16015 WP_001155227.1.16034 WP_001155227.1.1604 WP_001155227.1.16042 WP_001155227.1.16067 WP_001155227.1.16075 WP_001155227.1.16086 WP_001155227.1.16087 WP_001155227.1.1609 WP_001155227.1.16102 WP_001155227.1.16111 WP_001155227.1.16117 WP_001155227.1.16131 WP_001155227.1.16133 WP_001155227.1.16154 WP_001155227.1.16171 WP_001155227.1.16175 WP_001155227.1.16179 WP_001155227.1.16183 WP_001155227.1.16188 WP_001155227.1.16194 WP_001155227.1.1621 WP_001155227.1.1622 WP_001155227.1.16222 WP_001155227.1.16270 WP_001155227.1.16272 WP_001155227.1.16294 WP_001155227.1.163 WP_001155227.1.16303 WP_001155227.1.16322 WP_001155227.1.1634 WP_001155227.1.16387 WP_001155227.1.16388 WP_001155227.1.16396 WP_001155227.1.1640 WP_001155227.1.16435 WP_001155227.1.16463 WP_001155227.1.16481 WP_001155227.1.16482 WP_001155227.1.16500 WP_001155227.1.16532 WP_001155227.1.16539 WP_001155227.1.16541 WP_001155227.1.1655 WP_001155227.1.16577 WP_001155227.1.16592 WP_001155227.1.16604 WP_001155227.1.16608 WP_001155227.1.16612 WP_001155227.1.16640 WP_001155227.1.16648 WP_001155227.1.16667 WP_001155227.1.16669 WP_001155227.1.16682 WP_001155227.1.16685 WP_001155227.1.16705 WP_001155227.1.16715 WP_001155227.1.16721 WP_001155227.1.1673 WP_001155227.1.16745 WP_001155227.1.16752 WP_001155227.1.16766 WP_001155227.1.16780 WP_001155227.1.16798 WP_001155227.1.16799 WP_001155227.1.16805 WP_001155227.1.16807 WP_001155227.1.16818 WP_001155227.1.16843 WP_001155227.1.16845 WP_001155227.1.16861 WP_001155227.1.16862 WP_001155227.1.16894 WP_001155227.1.16927 WP_001155227.1.16970 WP_001155227.1.16979 WP_001155227.1.16992 WP_001155227.1.17014 WP_001155227.1.17017 WP_001155227.1.17018 WP_001155227.1.17028 WP_001155227.1.17042 WP_001155227.1.17061 WP_001155227.1.17084 WP_001155227.1.17085 WP_001155227.1.17087 WP_001155227.1.17089 WP_001155227.1.1710 WP_001155227.1.17101 WP_001155227.1.17102 WP_001155227.1.17109 WP_001155227.1.17111 WP_001155227.1.17114 WP_001155227.1.17119 WP_001155227.1.17123 WP_001155227.1.17150 WP_001155227.1.17153 WP_001155227.1.17170 WP_001155227.1.17172 WP_001155227.1.17179 WP_001155227.1.17182 WP_001155227.1.17187 WP_001155227.1.17205 WP_001155227.1.17206 WP_001155227.1.17216 WP_001155227.1.17230 WP_001155227.1.17241 WP_001155227.1.17242 WP_001155227.1.17267 WP_001155227.1.17282 WP_001155227.1.17290 WP_001155227.1.17297 WP_001155227.1.17300 WP_001155227.1.17301 WP_001155227.1.1731 WP_001155227.1.17325 WP_001155227.1.17333 WP_001155227.1.17356 WP_001155227.1.17360 WP_001155227.1.17373 WP_001155227.1.17386 WP_001155227.1.17387 WP_001155227.1.17389 WP_001155227.1.17392 WP_001155227.1.17403 WP_001155227.1.17410 WP_001155227.1.17415 WP_001155227.1.17416 WP_001155227.1.17417 WP_001155227.1.17432 WP_001155227.1.17441 WP_001155227.1.17461 WP_001155227.1.17464 WP_001155227.1.17496 WP_001155227.1.17515 WP_001155227.1.17534 WP_001155227.1.1754 WP_001155227.1.1755 WP_001155227.1.17550 WP_001155227.1.17568 WP_001155227.1.17570 WP_001155227.1.17577 WP_001155227.1.17584 WP_001155227.1.17595 WP_001155227.1.1762 WP_001155227.1.17623 WP_001155227.1.1763 WP_001155227.1.17637 WP_001155227.1.1766 WP_001155227.1.17680 WP_001155227.1.1769 WP_001155227.1.17701 WP_001155227.1.17711 WP_001155227.1.1772 WP_001155227.1.17734 WP_001155227.1.17757 WP_001155227.1.17765 WP_001155227.1.17766 WP_001155227.1.17769 WP_001155227.1.1778 WP_001155227.1.17802 WP_001155227.1.17829 WP_001155227.1.17831 WP_001155227.1.17836 WP_001155227.1.17849 WP_001155227.1.17889 WP_001155227.1.17904 WP_001155227.1.17920 WP_001155227.1.17925 WP_001155227.1.17937 WP_001155227.1.17952 WP_001155227.1.17961 WP_001155227.1.17963 WP_001155227.1.17984 WP_001155227.1.18000 WP_001155227.1.18006 WP_001155227.1.1802 WP_001155227.1.18024 WP_001155227.1.18050 WP_001155227.1.18064 WP_001155227.1.18094 WP_001155227.1.18112 WP_001155227.1.18118 WP_001155227.1.18121 WP_001155227.1.18133 WP_001155227.1.18134 WP_001155227.1.18136 WP_001155227.1.18141 WP_001155227.1.18164 WP_001155227.1.18175 WP_001155227.1.1821 WP_001155227.1.18225 WP_001155227.1.18226 WP_001155227.1.18229 WP_001155227.1.18275 WP_001155227.1.18311 WP_001155227.1.18316 WP_001155227.1.18326 WP_001155227.1.18329 WP_001155227.1.18337 WP_001155227.1.18338 WP_001155227.1.1834 WP_001155227.1.18340 WP_001155227.1.18348 WP_001155227.1.18354 WP_001155227.1.18381 WP_001155227.1.18383 WP_001155227.1.18394 WP_001155227.1.18402 WP_001155227.1.18410 WP_001155227.1.18420 WP_001155227.1.18428 WP_001155227.1.18436 WP_001155227.1.18438 WP_001155227.1.1844 WP_001155227.1.18458 WP_001155227.1.18461 WP_001155227.1.18472 WP_001155227.1.18482 WP_001155227.1.18519 WP_001155227.1.18530 WP_001155227.1.18550 WP_001155227.1.18556 WP_001155227.1.18581 WP_001155227.1.18583 WP_001155227.1.18588 WP_001155227.1.1861 WP_001155227.1.18617 WP_001155227.1.1862 WP_001155227.1.18628 WP_001155227.1.18649 WP_001155227.1.18651 WP_001155227.1.18655 WP_001155227.1.1866 WP_001155227.1.18666 WP_001155227.1.1867 WP_001155227.1.18675 WP_001155227.1.18699 WP_001155227.1.18714 WP_001155227.1.18725 WP_001155227.1.18726 WP_001155227.1.1873 WP_001155227.1.18734 WP_001155227.1.18794 WP_001155227.1.188 WP_001155227.1.18801 WP_001155227.1.18802 WP_001155227.1.18806 WP_001155227.1.1881 WP_001155227.1.18828 WP_001155227.1.18837 WP_001155227.1.18843 WP_001155227.1.18858 WP_001155227.1.18861 WP_001155227.1.18874 WP_001155227.1.18876 WP_001155227.1.18899 WP_001155227.1.18908 WP_001155227.1.18923 WP_001155227.1.18929 WP_001155227.1.18934 WP_001155227.1.18936 WP_001155227.1.1896 WP_001155227.1.18962 WP_001155227.1.18966 WP_001155227.1.18983 WP_001155227.1.18995 WP_001155227.1.19024 WP_001155227.1.1903 WP_001155227.1.19036 WP_001155227.1.19039 WP_001155227.1.1906 WP_001155227.1.19075 WP_001155227.1.1909 WP_001155227.1.19090 WP_001155227.1.191 WP_001155227.1.19100 WP_001155227.1.19113 WP_001155227.1.19114 WP_001155227.1.19122 WP_001155227.1.19129 WP_001155227.1.19135 WP_001155227.1.19140 WP_001155227.1.19146 WP_001155227.1.19147 WP_001155227.1.19148 WP_001155227.1.1915 WP_001155227.1.19150 WP_001155227.1.19153 WP_001155227.1.19171 WP_001155227.1.19194 WP_001155227.1.19205 WP_001155227.1.19206 WP_001155227.1.19245 WP_001155227.1.1925 WP_001155227.1.19250 WP_001155227.1.19276 WP_001155227.1.19277 WP_001155227.1.19297 WP_001155227.1.193 WP_001155227.1.19312 WP_001155227.1.19313 WP_001155227.1.19314 WP_001155227.1.19315 WP_001155227.1.19332 WP_001155227.1.19338 WP_001155227.1.19347 WP_001155227.1.19350 WP_001155227.1.19361 WP_001155227.1.19374 WP_001155227.1.19379 WP_001155227.1.19389 WP_001155227.1.19397 WP_001155227.1.19419 WP_001155227.1.19424 WP_001155227.1.19441 WP_001155227.1.19448 WP_001155227.1.19453 WP_001155227.1.19465 WP_001155227.1.19478 WP_001155227.1.19487 WP_001155227.1.19492 WP_001155227.1.19494 WP_001155227.1.19495 WP_001155227.1.1952 WP_001155227.1.19534 WP_001155227.1.19544 WP_001155227.1.19545 WP_001155227.1.19547 WP_001155227.1.19557 WP_001155227.1.19581 WP_001155227.1.19583 WP_001155227.1.19593 WP_001155227.1.1960 WP_001155227.1.19602 WP_001155227.1.19612 WP_001155227.1.1963 WP_001155227.1.19644 WP_001155227.1.19649 WP_001155227.1.19651 WP_001155227.1.19654 WP_001155227.1.19655 WP_001155227.1.19661 WP_001155227.1.19684 WP_001155227.1.19691 WP_001155227.1.19758 WP_001155227.1.19760 WP_001155227.1.19761 WP_001155227.1.19778 WP_001155227.1.19795 WP_001155227.1.1982 WP_001155227.1.19830 WP_001155227.1.19838 WP_001155227.1.19840 WP_001155227.1.19845 WP_001155227.1.19847 WP_001155227.1.19861 WP_001155227.1.1987 WP_001155227.1.19873 WP_001155227.1.19878 WP_001155227.1.19889 WP_001155227.1.19940 WP_001155227.1.19945 WP_001155227.1.19957 WP_001155227.1.19972 WP_001155227.1.19994 WP_001155227.1.20025 WP_001155227.1.2005 WP_001155227.1.20096 WP_001155227.1.20114 WP_001155227.1.20115 WP_001155227.1.20129 WP_001155227.1.20133 WP_001155227.1.20136 WP_001155227.1.2015 WP_001155227.1.20151 WP_001155227.1.20157 WP_001155227.1.20159 WP_001155227.1.20164 WP_001155227.1.20166 WP_001155227.1.20170 WP_001155227.1.20178 WP_001155227.1.20183 WP_001155227.1.20192 WP_001155227.1.20215 WP_001155227.1.2022 WP_001155227.1.20224 WP_001155227.1.20230 WP_001155227.1.20238 WP_001155227.1.20251 WP_001155227.1.20264 WP_001155227.1.2027 WP_001155227.1.20277 WP_001155227.1.20289 WP_001155227.1.20290 WP_001155227.1.20308 WP_001155227.1.20318 WP_001155227.1.20325 WP_001155227.1.20331 WP_001155227.1.20334 WP_001155227.1.20370 WP_001155227.1.20388 WP_001155227.1.20442 WP_001155227.1.20445 WP_001155227.1.20449 WP_001155227.1.20452 WP_001155227.1.20480 WP_001155227.1.20483 WP_001155227.1.20484 WP_001155227.1.20493 WP_001155227.1.20506 WP_001155227.1.20515 WP_001155227.1.20519 WP_001155227.1.20536 WP_001155227.1.20546 WP_001155227.1.20549 WP_001155227.1.20565 WP_001155227.1.20575 WP_001155227.1.20594 WP_001155227.1.20596 WP_001155227.1.20609 WP_001155227.1.2063 WP_001155227.1.20630 WP_001155227.1.20638 WP_001155227.1.20640 WP_001155227.1.20662 WP_001155227.1.20668 WP_001155227.1.20691 WP_001155227.1.20709 WP_001155227.1.20724 WP_001155227.1.20730 WP_001155227.1.20737 WP_001155227.1.20741 WP_001155227.1.20745 WP_001155227.1.2075 WP_001155227.1.20761 WP_001155227.1.20765 WP_001155227.1.20784 WP_001155227.1.20785 WP_001155227.1.20803 WP_001155227.1.20813 WP_001155227.1.20818 WP_001155227.1.20824 WP_001155227.1.20831 WP_001155227.1.20841 WP_001155227.1.20848 WP_001155227.1.20863 WP_001155227.1.2089 WP_001155227.1.20893 WP_001155227.1.20907 WP_001155227.1.2092 WP_001155227.1.2093 WP_001155227.1.20933 WP_001155227.1.2094 WP_001155227.1.20941 WP_001155227.1.20943 WP_001155227.1.20950 WP_001155227.1.20958 WP_001155227.1.20962 WP_001155227.1.20982 WP_001155227.1.20989 WP_001155227.1.2100 WP_001155227.1.21017 WP_001155227.1.21020 WP_001155227.1.21022 WP_001155227.1.21024 WP_001155227.1.21029 WP_001155227.1.21033 WP_001155227.1.21041 WP_001155227.1.21057 WP_001155227.1.21059 WP_001155227.1.21104 WP_001155227.1.21122 WP_001155227.1.21129 WP_001155227.1.2113 WP_001155227.1.21131 WP_001155227.1.21137 WP_001155227.1.21152 WP_001155227.1.21171 WP_001155227.1.21197 WP_001155227.1.21236 WP_001155227.1.21248 WP_001155227.1.21251 WP_001155227.1.21255 WP_001155227.1.21266 WP_001155227.1.21277 WP_001155227.1.21305 WP_001155227.1.21320 WP_001155227.1.21336 WP_001155227.1.21378 WP_001155227.1.2142 WP_001155227.1.21441 WP_001155227.1.21450 WP_001155227.1.21455 WP_001155227.1.21470 WP_001155227.1.21474 WP_001155227.1.21508 WP_001155227.1.21519 WP_001155227.1.2153 WP_001155227.1.21537 WP_001155227.1.2156 WP_001155227.1.21573 WP_001155227.1.21578 WP_001155227.1.21596 WP_001155227.1.21614 WP_001155227.1.21628 WP_001155227.1.21634 WP_001155227.1.21637 WP_001155227.1.2164 WP_001155227.1.21652 WP_001155227.1.21656 WP_001155227.1.21661 WP_001155227.1.21666 WP_001155227.1.21667 WP_001155227.1.21668 WP_001155227.1.21673 WP_001155227.1.21696 WP_001155227.1.21714 WP_001155227.1.21727 WP_001155227.1.21729 WP_001155227.1.21732 WP_001155227.1.21733 WP_001155227.1.21756 WP_001155227.1.21758 WP_001155227.1.21762 WP_001155227.1.21771 WP_001155227.1.21773 WP_001155227.1.21811 WP_001155227.1.21812 WP_001155227.1.21817 WP_001155227.1.21823 WP_001155227.1.21887 WP_001155227.1.21899 WP_001155227.1.21915 WP_001155227.1.21945 WP_001155227.1.21948 WP_001155227.1.21962 WP_001155227.1.2198 WP_001155227.1.21986 WP_001155227.1.21992 WP_001155227.1.22009 WP_001155227.1.22021 WP_001155227.1.22032 WP_001155227.1.22042 WP_001155227.1.22060 WP_001155227.1.22088 WP_001155227.1.22098 WP_001155227.1.22106 WP_001155227.1.22113 WP_001155227.1.22138 WP_001155227.1.22161 WP_001155227.1.2218 WP_001155227.1.22182 WP_001155227.1.22189 WP_001155227.1.22195 WP_001155227.1.22203 WP_001155227.1.22204 WP_001155227.1.22245 WP_001155227.1.22251 WP_001155227.1.22268 WP_001155227.1.22269 WP_001155227.1.22272 WP_001155227.1.22280 WP_001155227.1.22291 WP_001155227.1.22293 WP_001155227.1.22295 WP_001155227.1.22304 WP_001155227.1.22314 WP_001155227.1.22325 WP_001155227.1.22328 WP_001155227.1.22333 WP_001155227.1.2234 WP_001155227.1.22350 WP_001155227.1.22359 WP_001155227.1.22363 WP_001155227.1.22381 WP_001155227.1.22409 WP_001155227.1.2242 WP_001155227.1.22431 WP_001155227.1.2245 WP_001155227.1.22450 WP_001155227.1.22464 WP_001155227.1.22470 WP_001155227.1.22494 WP_001155227.1.22501 WP_001155227.1.22508 WP_001155227.1.22522 WP_001155227.1.22543 WP_001155227.1.22544 WP_001155227.1.22549 WP_001155227.1.22571 WP_001155227.1.22572 WP_001155227.1.22574 WP_001155227.1.22576 WP_001155227.1.22579 WP_001155227.1.22594 WP_001155227.1.22599 WP_001155227.1.22602 WP_001155227.1.22631 WP_001155227.1.22632 WP_001155227.1.22641 WP_001155227.1.22649 WP_001155227.1.22662 WP_001155227.1.22667 WP_001155227.1.22669 WP_001155227.1.22685 WP_001155227.1.22690 WP_001155227.1.22691 WP_001155227.1.22743 WP_001155227.1.22756 WP_001155227.1.22757 WP_001155227.1.22759 WP_001155227.1.22765 WP_001155227.1.22771 WP_001155227.1.22777 WP_001155227.1.22783 WP_001155227.1.22809 WP_001155227.1.22814 WP_001155227.1.22824 WP_001155227.1.22827 WP_001155227.1.22830 WP_001155227.1.22846 WP_001155227.1.22868 WP_001155227.1.22875 WP_001155227.1.22878 WP_001155227.1.22885 WP_001155227.1.22896 WP_001155227.1.22908 WP_001155227.1.22917 WP_001155227.1.22925 WP_001155227.1.22939 WP_001155227.1.22982 WP_001155227.1.22988 WP_001155227.1.22990 WP_001155227.1.22993 WP_001155227.1.2300 WP_001155227.1.23005 WP_001155227.1.23021 WP_001155227.1.23026 WP_001155227.1.23035 WP_001155227.1.23042 WP_001155227.1.23044 WP_001155227.1.23045 WP_001155227.1.23057 WP_001155227.1.23062 WP_001155227.1.23073 WP_001155227.1.23078 WP_001155227.1.23081 WP_001155227.1.23090 WP_001155227.1.23092 WP_001155227.1.23105 WP_001155227.1.23109 WP_001155227.1.23115 WP_001155227.1.23120 WP_001155227.1.23135 WP_001155227.1.2322 WP_001155227.1.23230 WP_001155227.1.23241 WP_001155227.1.23247 WP_001155227.1.2325 WP_001155227.1.23257 WP_001155227.1.23270 WP_001155227.1.23282 WP_001155227.1.23290 WP_001155227.1.23293 WP_001155227.1.23299 WP_001155227.1.23323 WP_001155227.1.23330 WP_001155227.1.23351 WP_001155227.1.23352 WP_001155227.1.23355 WP_001155227.1.23376 WP_001155227.1.23378 WP_001155227.1.23383 WP_001155227.1.23386 WP_001155227.1.23388 WP_001155227.1.23393 WP_001155227.1.23435 WP_001155227.1.23443 WP_001155227.1.23456 WP_001155227.1.23463 WP_001155227.1.23467 WP_001155227.1.23486 WP_001155227.1.23487 WP_001155227.1.23511 WP_001155227.1.23520 WP_001155227.1.23522 WP_001155227.1.23527 WP_001155227.1.23549 WP_001155227.1.23554 WP_001155227.1.23561 WP_001155227.1.23563 WP_001155227.1.23575 WP_001155227.1.23584 WP_001155227.1.23593 WP_001155227.1.2362 WP_001155227.1.23622 WP_001155227.1.23625 WP_001155227.1.23640 WP_001155227.1.23660 WP_001155227.1.23676 WP_001155227.1.23686 WP_001155227.1.23693 WP_001155227.1.23700 WP_001155227.1.23711 WP_001155227.1.23724 WP_001155227.1.23729 WP_001155227.1.23741 WP_001155227.1.23752 WP_001155227.1.23754 WP_001155227.1.23765 WP_001155227.1.23790 WP_001155227.1.23795 WP_001155227.1.23804 WP_001155227.1.23806 WP_001155227.1.23812 WP_001155227.1.23838 WP_001155227.1.23840 WP_001155227.1.23855 WP_001155227.1.23869 WP_001155227.1.2388 WP_001155227.1.23881 WP_001155227.1.23886 WP_001155227.1.23890 WP_001155227.1.23895 WP_001155227.1.23898 WP_001155227.1.23899 WP_001155227.1.23914 WP_001155227.1.23915 WP_001155227.1.23931 WP_001155227.1.23945 WP_001155227.1.2395 WP_001155227.1.23950 WP_001155227.1.23953 WP_001155227.1.23960 WP_001155227.1.23962 WP_001155227.1.23970 WP_001155227.1.23971 WP_001155227.1.23973 WP_001155227.1.23984 WP_001155227.1.23985 WP_001155227.1.24 WP_001155227.1.24004 WP_001155227.1.24024 WP_001155227.1.24038 WP_001155227.1.24045 WP_001155227.1.24051 WP_001155227.1.24058 WP_001155227.1.24068 WP_001155227.1.24070 WP_001155227.1.24088 WP_001155227.1.24089 WP_001155227.1.24120 WP_001155227.1.24122 WP_001155227.1.24124 WP_001155227.1.24127 WP_001155227.1.2413 WP_001155227.1.24136 WP_001155227.1.24169 WP_001155227.1.24170 WP_001155227.1.24177 WP_001155227.1.2418 WP_001155227.1.24194 WP_001155227.1.24233 WP_001155227.1.24278 WP_001155227.1.2428 WP_001155227.1.24283 WP_001155227.1.24290 WP_001155227.1.2430 WP_001155227.1.24304 WP_001155227.1.24316 WP_001155227.1.2433 WP_001155227.1.24341 WP_001155227.1.24362 WP_001155227.1.2437 WP_001155227.1.24374 WP_001155227.1.24381 WP_001155227.1.24383 WP_001155227.1.24458 WP_001155227.1.24460 WP_001155227.1.24473 WP_001155227.1.24483 WP_001155227.1.24485 WP_001155227.1.2449 WP_001155227.1.24499 WP_001155227.1.24523 WP_001155227.1.24524 WP_001155227.1.24533 WP_001155227.1.24536 WP_001155227.1.24547 WP_001155227.1.2456 WP_001155227.1.24560 WP_001155227.1.24568 WP_001155227.1.24570 WP_001155227.1.24575 WP_001155227.1.24577 WP_001155227.1.24583 WP_001155227.1.24592 WP_001155227.1.24616 WP_001155227.1.24634 WP_001155227.1.24641 WP_001155227.1.24642 WP_001155227.1.24646 WP_001155227.1.24650 WP_001155227.1.2469 WP_001155227.1.24693 WP_001155227.1.24695 WP_001155227.1.24703 WP_001155227.1.24753 WP_001155227.1.24758 WP_001155227.1.24763 WP_001155227.1.24773 WP_001155227.1.24783 WP_001155227.1.2479 WP_001155227.1.24791 WP_001155227.1.24797 WP_001155227.1.24799 WP_001155227.1.24808 WP_001155227.1.24849 WP_001155227.1.24854 WP_001155227.1.24870 WP_001155227.1.24876 WP_001155227.1.24899 WP_001155227.1.24902 WP_001155227.1.24906 WP_001155227.1.24909 WP_001155227.1.24926 WP_001155227.1.24929 WP_001155227.1.24939 WP_001155227.1.24946 WP_001155227.1.24960 WP_001155227.1.24968 WP_001155227.1.24976 WP_001155227.1.24979 WP_001155227.1.24981 WP_001155227.1.24982 WP_001155227.1.24984 WP_001155227.1.25019 WP_001155227.1.2502 WP_001155227.1.25021 WP_001155227.1.25038 WP_001155227.1.25039 WP_001155227.1.2504 WP_001155227.1.25042 WP_001155227.1.25050 WP_001155227.1.25060 WP_001155227.1.25076 WP_001155227.1.25078 WP_001155227.1.25079 WP_001155227.1.25082 WP_001155227.1.25085 WP_001155227.1.25086 WP_001155227.1.25087 WP_001155227.1.25088 WP_001155227.1.2512 WP_001155227.1.25126 WP_001155227.1.25141 WP_001155227.1.25174 WP_001155227.1.25183 WP_001155227.1.25193 WP_001155227.1.25201 WP_001155227.1.25203 WP_001155227.1.25204 WP_001155227.1.25248 WP_001155227.1.25268 WP_001155227.1.25270 WP_001155227.1.25272 WP_001155227.1.25289 WP_001155227.1.25305 WP_001155227.1.2531 WP_001155227.1.25312 WP_001155227.1.25324 WP_001155227.1.25346 WP_001155227.1.2537 WP_001155227.1.25372 WP_001155227.1.25378 WP_001155227.1.25380 WP_001155227.1.254 WP_001155227.1.2540 WP_001155227.1.25403 WP_001155227.1.25414 WP_001155227.1.25420 WP_001155227.1.2543 WP_001155227.1.25446 WP_001155227.1.25480 WP_001155227.1.255 WP_001155227.1.25517 WP_001155227.1.25525 WP_001155227.1.25526 WP_001155227.1.25548 WP_001155227.1.25577 WP_001155227.1.2558 WP_001155227.1.25592 WP_001155227.1.25598 WP_001155227.1.25602 WP_001155227.1.25612 WP_001155227.1.25613 WP_001155227.1.25631 WP_001155227.1.25643 WP_001155227.1.25652 WP_001155227.1.2567 WP_001155227.1.25680 WP_001155227.1.25681 WP_001155227.1.25701 WP_001155227.1.25712 WP_001155227.1.25713 WP_001155227.1.25717 WP_001155227.1.25718 WP_001155227.1.25724 WP_001155227.1.25726 WP_001155227.1.25750 WP_001155227.1.25753 WP_001155227.1.25755 WP_001155227.1.25794 WP_001155227.1.25799 WP_001155227.1.25819 WP_001155227.1.25831 WP_001155227.1.25832 WP_001155227.1.25843 WP_001155227.1.25855 WP_001155227.1.25869 WP_001155227.1.25873 WP_001155227.1.2588 WP_001155227.1.25886 WP_001155227.1.2589 WP_001155227.1.25890 WP_001155227.1.25895 WP_001155227.1.25915 WP_001155227.1.25945 WP_001155227.1.2597 WP_001155227.1.25996 WP_001155227.1.26005 WP_001155227.1.26040 WP_001155227.1.26048 WP_001155227.1.26055 WP_001155227.1.26061 WP_001155227.1.26066 WP_001155227.1.26076 WP_001155227.1.26092 WP_001155227.1.26100 WP_001155227.1.26105 WP_001155227.1.2612 WP_001155227.1.26121 WP_001155227.1.26125 WP_001155227.1.26130 WP_001155227.1.26131 WP_001155227.1.26134 WP_001155227.1.26135 WP_001155227.1.26150 WP_001155227.1.26161 WP_001155227.1.26175 WP_001155227.1.26186 WP_001155227.1.26189 WP_001155227.1.26191 WP_001155227.1.26196 WP_001155227.1.26246 WP_001155227.1.26259 WP_001155227.1.26262 WP_001155227.1.26264 WP_001155227.1.26270 WP_001155227.1.26284 WP_001155227.1.26304 WP_001155227.1.26325 WP_001155227.1.26331 WP_001155227.1.2637 WP_001155227.1.26379 WP_001155227.1.26391 WP_001155227.1.26398 WP_001155227.1.26401 WP_001155227.1.26403 WP_001155227.1.26419 WP_001155227.1.2642 WP_001155227.1.26438 WP_001155227.1.26443 WP_001155227.1.26467 WP_001155227.1.26474 WP_001155227.1.26479 WP_001155227.1.26480 WP_001155227.1.26488 WP_001155227.1.26514 WP_001155227.1.26517 WP_001155227.1.26525 WP_001155227.1.26569 WP_001155227.1.26570 WP_001155227.1.26574 WP_001155227.1.26575 WP_001155227.1.26579 WP_001155227.1.26588 WP_001155227.1.26590 WP_001155227.1.26598 WP_001155227.1.26609 WP_001155227.1.26613 WP_001155227.1.26627 WP_001155227.1.26644 WP_001155227.1.2665 WP_001155227.1.26658 WP_001155227.1.26659 WP_001155227.1.26660 WP_001155227.1.26683 WP_001155227.1.26688 WP_001155227.1.26716 WP_001155227.1.26720 WP_001155227.1.26736 WP_001155227.1.26761 WP_001155227.1.26782 WP_001155227.1.26837 WP_001155227.1.26839 WP_001155227.1.26861 WP_001155227.1.26878 WP_001155227.1.2688 WP_001155227.1.26912 WP_001155227.1.26932 WP_001155227.1.2694 WP_001155227.1.26941 WP_001155227.1.26943 WP_001155227.1.2695 WP_001155227.1.26950 WP_001155227.1.26975 WP_001155227.1.26987 WP_001155227.1.26995 WP_001155227.1.26998 WP_001155227.1.2700 WP_001155227.1.27019 WP_001155227.1.27043 WP_001155227.1.27057 WP_001155227.1.27060 WP_001155227.1.27091 WP_001155227.1.27098 WP_001155227.1.27101 WP_001155227.1.27105 WP_001155227.1.2712 WP_001155227.1.27134 WP_001155227.1.27141 WP_001155227.1.27148 WP_001155227.1.27175 WP_001155227.1.27188 WP_001155227.1.27214 WP_001155227.1.27234 WP_001155227.1.27260 WP_001155227.1.27280 WP_001155227.1.27283 WP_001155227.1.27287 WP_001155227.1.27292 WP_001155227.1.2731 WP_001155227.1.27310 WP_001155227.1.27313 WP_001155227.1.27330 WP_001155227.1.27338 WP_001155227.1.27367 WP_001155227.1.27373 WP_001155227.1.27389 WP_001155227.1.27396 WP_001155227.1.27401 WP_001155227.1.27424 WP_001155227.1.27426 WP_001155227.1.27445 WP_001155227.1.2745 WP_001155227.1.27451 WP_001155227.1.27472 WP_001155227.1.27504 WP_001155227.1.27518 WP_001155227.1.27520 WP_001155227.1.27524 WP_001155227.1.2755 WP_001155227.1.27560 WP_001155227.1.27580 WP_001155227.1.27585 WP_001155227.1.27611 WP_001155227.1.27618 WP_001155227.1.27683 WP_001155227.1.27691 WP_001155227.1.27693 WP_001155227.1.27698 WP_001155227.1.27723 WP_001155227.1.27734 WP_001155227.1.27741 WP_001155227.1.27742 WP_001155227.1.27749 WP_001155227.1.27758 WP_001155227.1.27774 WP_001155227.1.27786 WP_001155227.1.2779 WP_001155227.1.27797 WP_001155227.1.2782 WP_001155227.1.27846 WP_001155227.1.27856 WP_001155227.1.27861 WP_001155227.1.27871 WP_001155227.1.27876 WP_001155227.1.27879 WP_001155227.1.27897 WP_001155227.1.27911 WP_001155227.1.27913 WP_001155227.1.27923 WP_001155227.1.27932 WP_001155227.1.2794 WP_001155227.1.27957 WP_001155227.1.27971 WP_001155227.1.27998 WP_001155227.1.28008 WP_001155227.1.28026 WP_001155227.1.28027 WP_001155227.1.28046 WP_001155227.1.2805 WP_001155227.1.28051 WP_001155227.1.28102 WP_001155227.1.28109 WP_001155227.1.2811 WP_001155227.1.28110 WP_001155227.1.28128 WP_001155227.1.28143 WP_001155227.1.28145 WP_001155227.1.28156 WP_001155227.1.28167 WP_001155227.1.28168 WP_001155227.1.28184 WP_001155227.1.28199 WP_001155227.1.28222 WP_001155227.1.2823 WP_001155227.1.28250 WP_001155227.1.2826 WP_001155227.1.28268 WP_001155227.1.28271 WP_001155227.1.28305 WP_001155227.1.28318 WP_001155227.1.28322 WP_001155227.1.28345 WP_001155227.1.28349 WP_001155227.1.28371 WP_001155227.1.2838 WP_001155227.1.28401 WP_001155227.1.28414 WP_001155227.1.28433 WP_001155227.1.28440 WP_001155227.1.28461 WP_001155227.1.28476 WP_001155227.1.28480 WP_001155227.1.28491 WP_001155227.1.28496 WP_001155227.1.285 WP_001155227.1.28500 WP_001155227.1.28509 WP_001155227.1.28523 WP_001155227.1.28536 WP_001155227.1.28540 WP_001155227.1.28544 WP_001155227.1.28551 WP_001155227.1.28554 WP_001155227.1.28568 WP_001155227.1.28639 WP_001155227.1.2866 WP_001155227.1.28662 WP_001155227.1.28683 WP_001155227.1.28697 WP_001155227.1.28711 WP_001155227.1.28723 WP_001155227.1.28732 WP_001155227.1.28734 WP_001155227.1.28736 WP_001155227.1.28742 WP_001155227.1.28760 WP_001155227.1.28762 WP_001155227.1.28769 WP_001155227.1.28791 WP_001155227.1.28809 WP_001155227.1.2881 WP_001155227.1.28829 WP_001155227.1.28835 WP_001155227.1.28842 WP_001155227.1.28863 WP_001155227.1.28879 WP_001155227.1.28919 WP_001155227.1.28924 WP_001155227.1.28950 WP_001155227.1.28953 WP_001155227.1.28982 WP_001155227.1.28994 WP_001155227.1.290 WP_001155227.1.29001 WP_001155227.1.29013 WP_001155227.1.29016 WP_001155227.1.29026 WP_001155227.1.29049 WP_001155227.1.29051 WP_001155227.1.29055 WP_001155227.1.29061 WP_001155227.1.29079 WP_001155227.1.29082 WP_001155227.1.291 WP_001155227.1.29100 WP_001155227.1.29118 WP_001155227.1.29125 WP_001155227.1.29126 WP_001155227.1.29128 WP_001155227.1.29146 WP_001155227.1.29150 WP_001155227.1.29164 WP_001155227.1.29176 WP_001155227.1.29194 WP_001155227.1.29197 WP_001155227.1.29202 WP_001155227.1.29206 WP_001155227.1.29215 WP_001155227.1.29221 WP_001155227.1.29230 WP_001155227.1.29239 WP_001155227.1.29252 WP_001155227.1.29258 WP_001155227.1.2926 WP_001155227.1.2931 WP_001155227.1.29341 WP_001155227.1.29377 WP_001155227.1.29380 WP_001155227.1.29394 WP_001155227.1.29404 WP_001155227.1.2942 WP_001155227.1.29429 WP_001155227.1.29443 WP_001155227.1.2945 WP_001155227.1.29486 WP_001155227.1.29495 WP_001155227.1.29497 WP_001155227.1.29503 WP_001155227.1.29504 WP_001155227.1.29513 WP_001155227.1.2952 WP_001155227.1.29523 WP_001155227.1.2954 WP_001155227.1.29556 WP_001155227.1.29564 WP_001155227.1.29590 WP_001155227.1.29597 WP_001155227.1.29603 WP_001155227.1.29613 WP_001155227.1.29618 WP_001155227.1.2963 WP_001155227.1.29643 WP_001155227.1.29647 WP_001155227.1.29662 WP_001155227.1.29669 WP_001155227.1.29683 WP_001155227.1.29689 WP_001155227.1.29699 WP_001155227.1.29715 WP_001155227.1.29724 WP_001155227.1.29740 WP_001155227.1.29746 WP_001155227.1.29752 WP_001155227.1.2978 WP_001155227.1.29798 WP_001155227.1.29812 WP_001155227.1.29815 WP_001155227.1.29818 WP_001155227.1.29819 WP_001155227.1.29820 WP_001155227.1.29821 WP_001155227.1.29840 WP_001155227.1.2985 WP_001155227.1.29855 WP_001155227.1.29874 WP_001155227.1.29876 WP_001155227.1.29884 WP_001155227.1.29893 WP_001155227.1.29933 WP_001155227.1.2995 WP_001155227.1.29967 WP_001155227.1.29976 WP_001155227.1.29979 WP_001155227.1.29988 WP_001155227.1.29992 WP_001155227.1.30 WP_001155227.1.30004 WP_001155227.1.30016 WP_001155227.1.30019 WP_001155227.1.30035 WP_001155227.1.30052 WP_001155227.1.30063 WP_001155227.1.30064 WP_001155227.1.30098 WP_001155227.1.30105 WP_001155227.1.30123 WP_001155227.1.30141 WP_001155227.1.30164 WP_001155227.1.30178 WP_001155227.1.3018 WP_001155227.1.30214 WP_001155227.1.30221 WP_001155227.1.30222 WP_001155227.1.30231 WP_001155227.1.30232 WP_001155227.1.30239 WP_001155227.1.30247 WP_001155227.1.30253 WP_001155227.1.30269 WP_001155227.1.30298 WP_001155227.1.30347 WP_001155227.1.30391 WP_001155227.1.30397 WP_001155227.1.30399 WP_001155227.1.30400 WP_001155227.1.30401 WP_001155227.1.30428 WP_001155227.1.30447 WP_001155227.1.3045 WP_001155227.1.30452 WP_001155227.1.30472 WP_001155227.1.30476 WP_001155227.1.30479 WP_001155227.1.30497 WP_001155227.1.30524 WP_001155227.1.30536 WP_001155227.1.30537 WP_001155227.1.30546 WP_001155227.1.3055 WP_001155227.1.30550 WP_001155227.1.30554 WP_001155227.1.30570 WP_001155227.1.30580 WP_001155227.1.306 WP_001155227.1.3063 WP_001155227.1.30630 WP_001155227.1.30637 WP_001155227.1.30639 WP_001155227.1.30640 WP_001155227.1.30658 WP_001155227.1.30665 WP_001155227.1.30691 WP_001155227.1.30700 WP_001155227.1.30733 WP_001155227.1.30742 WP_001155227.1.30749 WP_001155227.1.30762 WP_001155227.1.30783 WP_001155227.1.30808 WP_001155227.1.3083 WP_001155227.1.30843 WP_001155227.1.30853 WP_001155227.1.30866 WP_001155227.1.30867 WP_001155227.1.30879 WP_001155227.1.30887 WP_001155227.1.30896 WP_001155227.1.309 WP_001155227.1.30905 WP_001155227.1.30906 WP_001155227.1.30918 WP_001155227.1.30960 WP_001155227.1.30987 WP_001155227.1.30993 WP_001155227.1.30999 WP_001155227.1.31000 WP_001155227.1.31009 WP_001155227.1.31017 WP_001155227.1.31026 WP_001155227.1.31029 WP_001155227.1.31055 WP_001155227.1.31083 WP_001155227.1.31089 WP_001155227.1.31119 WP_001155227.1.31129 WP_001155227.1.31142 WP_001155227.1.31149 WP_001155227.1.31154 WP_001155227.1.31158 WP_001155227.1.31188 WP_001155227.1.312 WP_001155227.1.31211 WP_001155227.1.31252 WP_001155227.1.31295 WP_001155227.1.31319 WP_001155227.1.31340 WP_001155227.1.31347 WP_001155227.1.31353 WP_001155227.1.31357 WP_001155227.1.31372 WP_001155227.1.31379 WP_001155227.1.3140 WP_001155227.1.31401 WP_001155227.1.31407 WP_001155227.1.31419 WP_001155227.1.31421 WP_001155227.1.31422 WP_001155227.1.31429 WP_001155227.1.31431 WP_001155227.1.31433 WP_001155227.1.31434 WP_001155227.1.3147 WP_001155227.1.31482 WP_001155227.1.31506 WP_001155227.1.31509 WP_001155227.1.31511 WP_001155227.1.31518 WP_001155227.1.31521 WP_001155227.1.31527 WP_001155227.1.31542 WP_001155227.1.31557 WP_001155227.1.31559 WP_001155227.1.31575 WP_001155227.1.31596 WP_001155227.1.31614 WP_001155227.1.31618 WP_001155227.1.31625 WP_001155227.1.31639 WP_001155227.1.31657 WP_001155227.1.31675 WP_001155227.1.31679 WP_001155227.1.31681 WP_001155227.1.3169 WP_001155227.1.31696 WP_001155227.1.31709 WP_001155227.1.31715 WP_001155227.1.31736 WP_001155227.1.31740 WP_001155227.1.3176 WP_001155227.1.31801 WP_001155227.1.31803 WP_001155227.1.31809 WP_001155227.1.3181 WP_001155227.1.31823 WP_001155227.1.31825 WP_001155227.1.31833 WP_001155227.1.31835 WP_001155227.1.31839 WP_001155227.1.31860 WP_001155227.1.31863 WP_001155227.1.31866 WP_001155227.1.31878 WP_001155227.1.31898 WP_001155227.1.31899 WP_001155227.1.31903 WP_001155227.1.31924 WP_001155227.1.31928 WP_001155227.1.3193 WP_001155227.1.31956 WP_001155227.1.31978 WP_001155227.1.3201 WP_001155227.1.32020 WP_001155227.1.32021 WP_001155227.1.32024 WP_001155227.1.3203 WP_001155227.1.32030 WP_001155227.1.32037 WP_001155227.1.32049 WP_001155227.1.32063 WP_001155227.1.32078 WP_001155227.1.32089 WP_001155227.1.32091 WP_001155227.1.32093 WP_001155227.1.32094 WP_001155227.1.3212 WP_001155227.1.32121 WP_001155227.1.32127 WP_001155227.1.32138 WP_001155227.1.32142 WP_001155227.1.32143 WP_001155227.1.3215 WP_001155227.1.32173 WP_001155227.1.32184 WP_001155227.1.322 WP_001155227.1.32222 WP_001155227.1.32225 WP_001155227.1.32232 WP_001155227.1.32234 WP_001155227.1.32236 WP_001155227.1.32242 WP_001155227.1.32243 WP_001155227.1.32279 WP_001155227.1.32287 WP_001155227.1.3233 WP_001155227.1.32333 WP_001155227.1.32394 WP_001155227.1.32406 WP_001155227.1.32432 WP_001155227.1.32435 WP_001155227.1.32443 WP_001155227.1.3247 WP_001155227.1.32475 WP_001155227.1.32478 WP_001155227.1.32479 WP_001155227.1.3248 WP_001155227.1.32480 WP_001155227.1.32494 WP_001155227.1.32509 WP_001155227.1.32518 WP_001155227.1.32536 WP_001155227.1.32558 WP_001155227.1.32561 WP_001155227.1.32574 WP_001155227.1.32580 WP_001155227.1.32587 WP_001155227.1.3259 WP_001155227.1.32590 WP_001155227.1.32591 WP_001155227.1.32601 WP_001155227.1.32635 WP_001155227.1.32650 WP_001155227.1.32655 WP_001155227.1.32661 WP_001155227.1.32676 WP_001155227.1.32680 WP_001155227.1.3269 WP_001155227.1.327 WP_001155227.1.32709 WP_001155227.1.32715 WP_001155227.1.32718 WP_001155227.1.32720 WP_001155227.1.32722 WP_001155227.1.32724 WP_001155227.1.32741 WP_001155227.1.32748 WP_001155227.1.32772 WP_001155227.1.32811 WP_001155227.1.32815 WP_001155227.1.32831 WP_001155227.1.32835 WP_001155227.1.32875 WP_001155227.1.32888 WP_001155227.1.32903 WP_001155227.1.32910 WP_001155227.1.32931 WP_001155227.1.32938 WP_001155227.1.32946 WP_001155227.1.3295 WP_001155227.1.32959 WP_001155227.1.32972 WP_001155227.1.32984 WP_001155227.1.32992 WP_001155227.1.32995 WP_001155227.1.33004 WP_001155227.1.33014 WP_001155227.1.33018 WP_001155227.1.33022 WP_001155227.1.33026 WP_001155227.1.33046 WP_001155227.1.33049 WP_001155227.1.33053 WP_001155227.1.33055 WP_001155227.1.33094 WP_001155227.1.33101 WP_001155227.1.33119 WP_001155227.1.33125 WP_001155227.1.33146 WP_001155227.1.33171 WP_001155227.1.33178 WP_001155227.1.33179 WP_001155227.1.33190 WP_001155227.1.33217 WP_001155227.1.33222 WP_001155227.1.3323 WP_001155227.1.33237 WP_001155227.1.33238 WP_001155227.1.33244 WP_001155227.1.33268 WP_001155227.1.33303 WP_001155227.1.33325 WP_001155227.1.33341 WP_001155227.1.33352 WP_001155227.1.33362 WP_001155227.1.33369 WP_001155227.1.33385 WP_001155227.1.334 WP_001155227.1.33408 WP_001155227.1.33410 WP_001155227.1.33413 WP_001155227.1.33422 WP_001155227.1.33424 WP_001155227.1.33428 WP_001155227.1.3344 WP_001155227.1.33475 WP_001155227.1.33476 WP_001155227.1.33502 WP_001155227.1.33525 WP_001155227.1.33526 WP_001155227.1.3354 WP_001155227.1.33545 WP_001155227.1.33563 WP_001155227.1.33565 WP_001155227.1.33584 WP_001155227.1.33595 WP_001155227.1.33631 WP_001155227.1.33638 WP_001155227.1.33648 WP_001155227.1.33667 WP_001155227.1.33680 WP_001155227.1.33736 WP_001155227.1.33745 WP_001155227.1.33746 WP_001155227.1.33751 WP_001155227.1.33780 WP_001155227.1.33799 WP_001155227.1.33823 WP_001155227.1.33853 WP_001155227.1.33854 WP_001155227.1.33879 WP_001155227.1.33888 WP_001155227.1.33896 WP_001155227.1.33905 WP_001155227.1.33914 WP_001155227.1.33948 WP_001155227.1.33952 WP_001155227.1.33973 WP_001155227.1.33974 WP_001155227.1.33979 WP_001155227.1.3398 WP_001155227.1.33981 WP_001155227.1.34003 WP_001155227.1.3401 WP_001155227.1.34032 WP_001155227.1.34094 WP_001155227.1.3411 WP_001155227.1.34117 WP_001155227.1.34121 WP_001155227.1.34122 WP_001155227.1.34124 WP_001155227.1.34130 WP_001155227.1.34134 WP_001155227.1.34144 WP_001155227.1.3415 WP_001155227.1.342 WP_001155227.1.34204 WP_001155227.1.34206 WP_001155227.1.34208 WP_001155227.1.34224 WP_001155227.1.34269 WP_001155227.1.34270 WP_001155227.1.34273 WP_001155227.1.34294 WP_001155227.1.34303 WP_001155227.1.3432 WP_001155227.1.34332 WP_001155227.1.34341 WP_001155227.1.34348 WP_001155227.1.34362 WP_001155227.1.34363 WP_001155227.1.34380 WP_001155227.1.34383 WP_001155227.1.3439 WP_001155227.1.34397 WP_001155227.1.34400 WP_001155227.1.34422 WP_001155227.1.34426 WP_001155227.1.3444 WP_001155227.1.34440 WP_001155227.1.34441 WP_001155227.1.34444 WP_001155227.1.34456 WP_001155227.1.34464 WP_001155227.1.34470 WP_001155227.1.34483 WP_001155227.1.34500 WP_001155227.1.34525 WP_001155227.1.34528 WP_001155227.1.34532 WP_001155227.1.34538 WP_001155227.1.34541 WP_001155227.1.34557 WP_001155227.1.34558 WP_001155227.1.3460 WP_001155227.1.34605 WP_001155227.1.34617 WP_001155227.1.34655 WP_001155227.1.34668 WP_001155227.1.34675 WP_001155227.1.34680 WP_001155227.1.34682 WP_001155227.1.34683 WP_001155227.1.34686 WP_001155227.1.3469 WP_001155227.1.347 WP_001155227.1.34712 WP_001155227.1.3472 WP_001155227.1.34727 WP_001155227.1.34763 WP_001155227.1.34781 WP_001155227.1.34782 WP_001155227.1.34794 WP_001155227.1.34827 WP_001155227.1.34835 WP_001155227.1.34838 WP_001155227.1.34855 WP_001155227.1.34875 WP_001155227.1.34887 WP_001155227.1.34913 WP_001155227.1.34931 WP_001155227.1.34948 WP_001155227.1.34966 WP_001155227.1.34982 WP_001155227.1.34983 WP_001155227.1.34990 WP_001155227.1.34993 WP_001155227.1.35003 WP_001155227.1.35006 WP_001155227.1.35007 WP_001155227.1.35012 WP_001155227.1.35039 WP_001155227.1.35107 WP_001155227.1.35114 WP_001155227.1.35127 WP_001155227.1.35132 WP_001155227.1.3515 WP_001155227.1.35168 WP_001155227.1.35180 WP_001155227.1.35186 WP_001155227.1.35195 WP_001155227.1.35198 WP_001155227.1.35202 WP_001155227.1.35204 WP_001155227.1.35208 WP_001155227.1.3521 WP_001155227.1.35211 WP_001155227.1.35220 WP_001155227.1.35253 WP_001155227.1.35258 WP_001155227.1.35316 WP_001155227.1.35328 WP_001155227.1.35349 WP_001155227.1.35360 WP_001155227.1.35365 WP_001155227.1.35368 WP_001155227.1.35376 WP_001155227.1.3539 WP_001155227.1.35393 WP_001155227.1.35394 WP_001155227.1.35398 WP_001155227.1.35448 WP_001155227.1.35464 WP_001155227.1.35465 WP_001155227.1.35466 WP_001155227.1.35468 WP_001155227.1.35483 WP_001155227.1.3550 WP_001155227.1.35522 WP_001155227.1.35552 WP_001155227.1.35578 WP_001155227.1.35581 WP_001155227.1.3560 WP_001155227.1.35604 WP_001155227.1.35627 WP_001155227.1.35632 WP_001155227.1.35649 WP_001155227.1.35651 WP_001155227.1.35653 WP_001155227.1.35654 WP_001155227.1.35698 WP_001155227.1.35724 WP_001155227.1.35740 WP_001155227.1.35741 WP_001155227.1.35744 WP_001155227.1.35789 WP_001155227.1.35889 WP_001155227.1.35904 WP_001155227.1.35922 WP_001155227.1.35927 WP_001155227.1.35934 WP_001155227.1.35942 WP_001155227.1.35959 WP_001155227.1.35963 WP_001155227.1.3598 WP_001155227.1.35985 WP_001155227.1.35987 WP_001155227.1.35990 WP_001155227.1.360 WP_001155227.1.3600 WP_001155227.1.36010 WP_001155227.1.36040 WP_001155227.1.36042 WP_001155227.1.36070 WP_001155227.1.36071 WP_001155227.1.36085 WP_001155227.1.36094 WP_001155227.1.36105 WP_001155227.1.36129 WP_001155227.1.36132 WP_001155227.1.36158 WP_001155227.1.36159 WP_001155227.1.36164 WP_001155227.1.36166 WP_001155227.1.36177 WP_001155227.1.36182 WP_001155227.1.3620 WP_001155227.1.36207 WP_001155227.1.36212 WP_001155227.1.3624 WP_001155227.1.36281 WP_001155227.1.36299 WP_001155227.1.36334 WP_001155227.1.36352 WP_001155227.1.36386 WP_001155227.1.36393 WP_001155227.1.36405 WP_001155227.1.36412 WP_001155227.1.36414 WP_001155227.1.36426 WP_001155227.1.3643 WP_001155227.1.36459 WP_001155227.1.36496 WP_001155227.1.365 WP_001155227.1.36500 WP_001155227.1.36507 WP_001155227.1.36523 WP_001155227.1.36531 WP_001155227.1.36537 WP_001155227.1.36545 WP_001155227.1.36610 WP_001155227.1.36626 WP_001155227.1.36627 WP_001155227.1.36628 WP_001155227.1.36667 WP_001155227.1.3668 WP_001155227.1.36699 WP_001155227.1.36707 WP_001155227.1.3671 WP_001155227.1.36724 WP_001155227.1.36739 WP_001155227.1.36746 WP_001155227.1.36747 WP_001155227.1.36761 WP_001155227.1.36767 WP_001155227.1.36786 WP_001155227.1.36799 WP_001155227.1.36806 WP_001155227.1.36812 WP_001155227.1.36817 WP_001155227.1.36826 WP_001155227.1.36833 WP_001155227.1.36841 WP_001155227.1.36856 WP_001155227.1.36886 WP_001155227.1.36894 WP_001155227.1.36904 WP_001155227.1.36925 WP_001155227.1.3697 WP_001155227.1.36971 WP_001155227.1.36975 WP_001155227.1.37006 WP_001155227.1.37020 WP_001155227.1.37032 WP_001155227.1.37046 WP_001155227.1.37049 WP_001155227.1.37057 WP_001155227.1.37076 WP_001155227.1.37099 WP_001155227.1.37101 WP_001155227.1.37102 WP_001155227.1.37103 WP_001155227.1.37109 WP_001155227.1.37122 WP_001155227.1.37146 WP_001155227.1.3715 WP_001155227.1.37153 WP_001155227.1.37155 WP_001155227.1.37173 WP_001155227.1.37206 WP_001155227.1.37226 WP_001155227.1.3723 WP_001155227.1.37233 WP_001155227.1.37252 WP_001155227.1.37261 WP_001155227.1.37266 WP_001155227.1.37290 WP_001155227.1.3730 WP_001155227.1.37306 WP_001155227.1.37312 WP_001155227.1.37313 WP_001155227.1.37329 WP_001155227.1.37334 WP_001155227.1.37337 WP_001155227.1.37342 WP_001155227.1.37352 WP_001155227.1.37360 WP_001155227.1.37371 WP_001155227.1.37372 WP_001155227.1.37388 WP_001155227.1.37419 WP_001155227.1.37423 WP_001155227.1.37433 WP_001155227.1.37445 WP_001155227.1.37472 WP_001155227.1.37476 WP_001155227.1.37477 WP_001155227.1.37485 WP_001155227.1.3749 WP_001155227.1.37510 WP_001155227.1.37516 WP_001155227.1.37538 WP_001155227.1.37543 WP_001155227.1.37544 WP_001155227.1.37548 WP_001155227.1.37549 WP_001155227.1.37550 WP_001155227.1.37554 WP_001155227.1.37555 WP_001155227.1.37576 WP_001155227.1.37588 WP_001155227.1.37592 WP_001155227.1.37608 WP_001155227.1.3762 WP_001155227.1.37634 WP_001155227.1.37637 WP_001155227.1.37664 WP_001155227.1.377 WP_001155227.1.3772 WP_001155227.1.37730 WP_001155227.1.37731 WP_001155227.1.37736 WP_001155227.1.37745 WP_001155227.1.37750 WP_001155227.1.37758 WP_001155227.1.37762 WP_001155227.1.37766 WP_001155227.1.37769 WP_001155227.1.37773 WP_001155227.1.37817 WP_001155227.1.37830 WP_001155227.1.37847 WP_001155227.1.37852 WP_001155227.1.37853 WP_001155227.1.3788 WP_001155227.1.37880 WP_001155227.1.37887 WP_001155227.1.37897 WP_001155227.1.37917 WP_001155227.1.37923 WP_001155227.1.37926 WP_001155227.1.37940 WP_001155227.1.3795 WP_001155227.1.3796 WP_001155227.1.37962 WP_001155227.1.37964 WP_001155227.1.37967 WP_001155227.1.37984 WP_001155227.1.37995 WP_001155227.1.37998 WP_001155227.1.38000 WP_001155227.1.38033 WP_001155227.1.38043 WP_001155227.1.38050 WP_001155227.1.38063 WP_001155227.1.38080 WP_001155227.1.38081 WP_001155227.1.38085 WP_001155227.1.38103 WP_001155227.1.38105 WP_001155227.1.38107 WP_001155227.1.3811 WP_001155227.1.38119 WP_001155227.1.38120 WP_001155227.1.38143 WP_001155227.1.3815 WP_001155227.1.38155 WP_001155227.1.38162 WP_001155227.1.38182 WP_001155227.1.38185 WP_001155227.1.38194 WP_001155227.1.38202 WP_001155227.1.38211 WP_001155227.1.3822 WP_001155227.1.38225 WP_001155227.1.38234 WP_001155227.1.38257 WP_001155227.1.38300 WP_001155227.1.38306 WP_001155227.1.38312 WP_001155227.1.38314 WP_001155227.1.38323 WP_001155227.1.38357 WP_001155227.1.38363 WP_001155227.1.38369 WP_001155227.1.38371 WP_001155227.1.38392 WP_001155227.1.38412 WP_001155227.1.38419 WP_001155227.1.38485 WP_001155227.1.38533 WP_001155227.1.38544 WP_001155227.1.38561 WP_001155227.1.38567 WP_001155227.1.38584 WP_001155227.1.38626 WP_001155227.1.38629 WP_001155227.1.38636 WP_001155227.1.38694 WP_001155227.1.38722 WP_001155227.1.3873 WP_001155227.1.38751 WP_001155227.1.38777 WP_001155227.1.38782 WP_001155227.1.38811 WP_001155227.1.38827 WP_001155227.1.38835 WP_001155227.1.38843 WP_001155227.1.38896 WP_001155227.1.389 WP_001155227.1.38911 WP_001155227.1.38920 WP_001155227.1.38935 WP_001155227.1.38937 WP_001155227.1.38950 WP_001155227.1.38956 WP_001155227.1.38958 WP_001155227.1.39005 WP_001155227.1.39015 WP_001155227.1.3903 WP_001155227.1.39037 WP_001155227.1.3904 WP_001155227.1.39042 WP_001155227.1.39049 WP_001155227.1.39063 WP_001155227.1.39103 WP_001155227.1.3912 WP_001155227.1.39123 WP_001155227.1.39148 WP_001155227.1.39150 WP_001155227.1.39155 WP_001155227.1.39157 WP_001155227.1.39163 WP_001155227.1.39164 WP_001155227.1.39167 WP_001155227.1.39171 WP_001155227.1.39180 WP_001155227.1.39184 WP_001155227.1.39196 WP_001155227.1.39209 WP_001155227.1.3921 WP_001155227.1.3922 WP_001155227.1.39232 WP_001155227.1.39249 WP_001155227.1.39254 WP_001155227.1.39268 WP_001155227.1.39286 WP_001155227.1.39289 WP_001155227.1.39302 WP_001155227.1.39305 WP_001155227.1.39310 WP_001155227.1.39313 WP_001155227.1.39325 WP_001155227.1.39327 WP_001155227.1.39335 WP_001155227.1.39342 WP_001155227.1.39356 WP_001155227.1.39358 WP_001155227.1.39365 WP_001155227.1.39367 WP_001155227.1.39373 WP_001155227.1.39377 WP_001155227.1.39401 WP_001155227.1.39402 WP_001155227.1.39415 WP_001155227.1.39423 WP_001155227.1.39430 WP_001155227.1.39468 WP_001155227.1.39481 WP_001155227.1.39492 WP_001155227.1.39509 WP_001155227.1.39531 WP_001155227.1.3954 WP_001155227.1.39541 WP_001155227.1.39564 WP_001155227.1.39575 WP_001155227.1.39580 WP_001155227.1.39594 WP_001155227.1.39601 WP_001155227.1.39606 WP_001155227.1.39607 WP_001155227.1.39610 WP_001155227.1.39626 WP_001155227.1.39636 WP_001155227.1.39646 WP_001155227.1.39651 WP_001155227.1.39690 WP_001155227.1.3970 WP_001155227.1.39708 WP_001155227.1.39709 WP_001155227.1.39713 WP_001155227.1.39715 WP_001155227.1.39717 WP_001155227.1.39726 WP_001155227.1.39729 WP_001155227.1.39730 WP_001155227.1.39733 WP_001155227.1.39734 WP_001155227.1.39758 WP_001155227.1.39764 WP_001155227.1.39780 WP_001155227.1.39796 WP_001155227.1.3980 WP_001155227.1.39809 WP_001155227.1.39818 WP_001155227.1.39820 WP_001155227.1.39822 WP_001155227.1.39829 WP_001155227.1.39867 WP_001155227.1.39870 WP_001155227.1.39892 WP_001155227.1.39938 WP_001155227.1.39961 WP_001155227.1.39966 WP_001155227.1.39970 WP_001155227.1.39973 WP_001155227.1.39992 WP_001155227.1.40 WP_001155227.1.40013 WP_001155227.1.40016 WP_001155227.1.40019 WP_001155227.1.40036 WP_001155227.1.4005 WP_001155227.1.40083 WP_001155227.1.40088 WP_001155227.1.40107 WP_001155227.1.40113 WP_001155227.1.40121 WP_001155227.1.40140 WP_001155227.1.40147 WP_001155227.1.40153 WP_001155227.1.40159 WP_001155227.1.40183 WP_001155227.1.40190 WP_001155227.1.40192 WP_001155227.1.4020 WP_001155227.1.40206 WP_001155227.1.40211 WP_001155227.1.40212 WP_001155227.1.40218 WP_001155227.1.40234 WP_001155227.1.40238 WP_001155227.1.40249 WP_001155227.1.40298 WP_001155227.1.4030 WP_001155227.1.40300 WP_001155227.1.40315 WP_001155227.1.40317 WP_001155227.1.40319 WP_001155227.1.40335 WP_001155227.1.40344 WP_001155227.1.40345 WP_001155227.1.40349 WP_001155227.1.40360 WP_001155227.1.40382 WP_001155227.1.40389 WP_001155227.1.40391 WP_001155227.1.40403 WP_001155227.1.40445 WP_001155227.1.40486 WP_001155227.1.4049 WP_001155227.1.40499 WP_001155227.1.40502 WP_001155227.1.40509 WP_001155227.1.40524 WP_001155227.1.40539 WP_001155227.1.40548 WP_001155227.1.40549 WP_001155227.1.40560 WP_001155227.1.40563 WP_001155227.1.40596 WP_001155227.1.40599 WP_001155227.1.406 WP_001155227.1.40607 WP_001155227.1.40617 WP_001155227.1.40623 WP_001155227.1.40629 WP_001155227.1.40636 WP_001155227.1.40657 WP_001155227.1.40660 WP_001155227.1.40666 WP_001155227.1.40668 WP_001155227.1.40686 WP_001155227.1.40712 WP_001155227.1.40715 WP_001155227.1.40742 WP_001155227.1.40758 WP_001155227.1.40781 WP_001155227.1.40791 WP_001155227.1.40793 WP_001155227.1.4081 WP_001155227.1.40813 WP_001155227.1.40815 WP_001155227.1.4082 WP_001155227.1.40833 WP_001155227.1.40842 WP_001155227.1.40843 WP_001155227.1.40865 WP_001155227.1.40882 WP_001155227.1.40893 WP_001155227.1.40898 WP_001155227.1.40900 WP_001155227.1.40912 WP_001155227.1.40937 WP_001155227.1.40952 WP_001155227.1.40965 WP_001155227.1.4103 WP_001155227.1.41037 WP_001155227.1.41041 WP_001155227.1.41045 WP_001155227.1.41060 WP_001155227.1.41063 WP_001155227.1.41078 WP_001155227.1.41113 WP_001155227.1.41125 WP_001155227.1.41147 WP_001155227.1.41206 WP_001155227.1.4122 WP_001155227.1.41230 WP_001155227.1.41239 WP_001155227.1.41259 WP_001155227.1.4126 WP_001155227.1.41263 WP_001155227.1.41271 WP_001155227.1.41287 WP_001155227.1.41294 WP_001155227.1.41315 WP_001155227.1.41330 WP_001155227.1.41332 WP_001155227.1.41339 WP_001155227.1.41346 WP_001155227.1.41363 WP_001155227.1.41368 WP_001155227.1.41371 WP_001155227.1.41372 WP_001155227.1.41391 WP_001155227.1.41392 WP_001155227.1.41394 WP_001155227.1.41401 WP_001155227.1.41402 WP_001155227.1.41407 WP_001155227.1.41417 WP_001155227.1.4142 WP_001155227.1.41436 WP_001155227.1.41449 WP_001155227.1.41453 WP_001155227.1.41455 WP_001155227.1.41457 WP_001155227.1.41466 WP_001155227.1.41478 WP_001155227.1.41479 WP_001155227.1.41481 WP_001155227.1.41482 WP_001155227.1.41483 WP_001155227.1.41484 WP_001155227.1.41488 WP_001155227.1.41513 WP_001155227.1.41530 WP_001155227.1.41536 WP_001155227.1.41539 WP_001155227.1.41545 WP_001155227.1.41556 WP_001155227.1.41566 WP_001155227.1.4158 WP_001155227.1.41606 WP_001155227.1.41613 WP_001155227.1.41621 WP_001155227.1.41651 WP_001155227.1.41654 WP_001155227.1.41665 WP_001155227.1.41712 WP_001155227.1.41718 WP_001155227.1.4172 WP_001155227.1.41734 WP_001155227.1.41740 WP_001155227.1.41741 WP_001155227.1.41752 WP_001155227.1.41778 WP_001155227.1.41780 WP_001155227.1.41782 WP_001155227.1.41783 WP_001155227.1.41784 WP_001155227.1.41809 WP_001155227.1.41812 WP_001155227.1.41813 WP_001155227.1.41822 WP_001155227.1.41826 WP_001155227.1.41837 WP_001155227.1.41847 WP_001155227.1.41849 WP_001155227.1.41884 WP_001155227.1.41885 WP_001155227.1.4189 WP_001155227.1.41900 WP_001155227.1.41923 WP_001155227.1.4193 WP_001155227.1.41956 WP_001155227.1.41960 WP_001155227.1.41964 WP_001155227.1.41988 WP_001155227.1.41990 WP_001155227.1.41991 WP_001155227.1.42022 WP_001155227.1.42027 WP_001155227.1.42033 WP_001155227.1.42036 WP_001155227.1.42038 WP_001155227.1.42044 WP_001155227.1.42060 WP_001155227.1.42073 WP_001155227.1.42095 WP_001155227.1.42096 WP_001155227.1.42113 WP_001155227.1.4213 WP_001155227.1.42138 WP_001155227.1.4214 WP_001155227.1.42151 WP_001155227.1.42159 WP_001155227.1.42179 WP_001155227.1.42191 WP_001155227.1.42203 WP_001155227.1.42209 WP_001155227.1.42214 WP_001155227.1.42221 WP_001155227.1.42223 WP_001155227.1.42226 WP_001155227.1.42228 WP_001155227.1.42233 WP_001155227.1.4224 WP_001155227.1.42252 WP_001155227.1.42258 WP_001155227.1.42277 WP_001155227.1.42284 WP_001155227.1.42300 WP_001155227.1.42318 WP_001155227.1.42350 WP_001155227.1.42359 WP_001155227.1.42367 WP_001155227.1.42369 WP_001155227.1.42376 WP_001155227.1.42387 WP_001155227.1.42413 WP_001155227.1.42415 WP_001155227.1.4242 WP_001155227.1.42432 WP_001155227.1.42442 WP_001155227.1.42443 WP_001155227.1.42447 WP_001155227.1.42448 WP_001155227.1.42456 WP_001155227.1.42480 WP_001155227.1.42482 WP_001155227.1.4250 WP_001155227.1.42513 WP_001155227.1.42516 WP_001155227.1.42522 WP_001155227.1.42586 WP_001155227.1.42594 WP_001155227.1.42597 WP_001155227.1.42600 WP_001155227.1.42601 WP_001155227.1.4261 WP_001155227.1.42632 WP_001155227.1.42638 WP_001155227.1.42661 WP_001155227.1.42669 WP_001155227.1.42670 WP_001155227.1.42677 WP_001155227.1.42709 WP_001155227.1.42728 WP_001155227.1.42748 WP_001155227.1.42749 WP_001155227.1.42750 WP_001155227.1.42756 WP_001155227.1.42770 WP_001155227.1.42771 WP_001155227.1.42791 WP_001155227.1.42804 WP_001155227.1.42808 WP_001155227.1.42813 WP_001155227.1.4282 WP_001155227.1.42828 WP_001155227.1.42830 WP_001155227.1.42832 WP_001155227.1.42863 WP_001155227.1.42879 WP_001155227.1.42880 WP_001155227.1.42891 WP_001155227.1.4290 WP_001155227.1.42903 WP_001155227.1.42936 WP_001155227.1.42937 WP_001155227.1.42950 WP_001155227.1.42962 WP_001155227.1.42966 WP_001155227.1.42970 WP_001155227.1.42975 WP_001155227.1.42987 WP_001155227.1.42989 WP_001155227.1.42991 WP_001155227.1.43013 WP_001155227.1.43027 WP_001155227.1.43035 WP_001155227.1.4306 WP_001155227.1.43079 WP_001155227.1.43121 WP_001155227.1.43123 WP_001155227.1.4313 WP_001155227.1.43132 WP_001155227.1.43133 WP_001155227.1.43137 WP_001155227.1.43140 WP_001155227.1.43166 WP_001155227.1.43170 WP_001155227.1.43174 WP_001155227.1.43177 WP_001155227.1.43196 WP_001155227.1.43213 WP_001155227.1.43216 WP_001155227.1.43239 WP_001155227.1.43270 WP_001155227.1.43278 WP_001155227.1.43316 WP_001155227.1.43324 WP_001155227.1.4334 WP_001155227.1.43363 WP_001155227.1.43374 WP_001155227.1.43384 WP_001155227.1.43389 WP_001155227.1.4342 WP_001155227.1.43422 WP_001155227.1.43427 WP_001155227.1.4343 WP_001155227.1.43444 WP_001155227.1.43448 WP_001155227.1.43455 WP_001155227.1.43469 WP_001155227.1.43473 WP_001155227.1.43474 WP_001155227.1.43489 WP_001155227.1.43501 WP_001155227.1.43536 WP_001155227.1.4356 WP_001155227.1.43561 WP_001155227.1.43566 WP_001155227.1.43598 WP_001155227.1.436 WP_001155227.1.43604 WP_001155227.1.43622 WP_001155227.1.43642 WP_001155227.1.43720 WP_001155227.1.43733 WP_001155227.1.43738 WP_001155227.1.43750 WP_001155227.1.43754 WP_001155227.1.43769 WP_001155227.1.43798 WP_001155227.1.43803 WP_001155227.1.43804 WP_001155227.1.43816 WP_001155227.1.43837 WP_001155227.1.43858 WP_001155227.1.43868 WP_001155227.1.43898 WP_001155227.1.43911 WP_001155227.1.43918 WP_001155227.1.43925 WP_001155227.1.43939 WP_001155227.1.43942 WP_001155227.1.43953 WP_001155227.1.43966 WP_001155227.1.43989 WP_001155227.1.440 WP_001155227.1.4400 WP_001155227.1.44018 WP_001155227.1.44020 WP_001155227.1.44029 WP_001155227.1.44040 WP_001155227.1.44051 WP_001155227.1.44053 WP_001155227.1.44075 WP_001155227.1.44077 WP_001155227.1.44088 WP_001155227.1.44096 WP_001155227.1.44100 WP_001155227.1.4411 WP_001155227.1.44115 WP_001155227.1.44125 WP_001155227.1.44130 WP_001155227.1.44133 WP_001155227.1.4415 WP_001155227.1.44162 WP_001155227.1.44165 WP_001155227.1.44166 WP_001155227.1.44201 WP_001155227.1.44203 WP_001155227.1.44211 WP_001155227.1.44222 WP_001155227.1.44238 WP_001155227.1.44251 WP_001155227.1.44263 WP_001155227.1.44264 WP_001155227.1.44273 WP_001155227.1.44285 WP_001155227.1.44287 WP_001155227.1.44292 WP_001155227.1.44314 WP_001155227.1.44324 WP_001155227.1.44327 WP_001155227.1.44354 WP_001155227.1.44365 WP_001155227.1.44389 WP_001155227.1.44394 WP_001155227.1.44422 WP_001155227.1.44424 WP_001155227.1.44426 WP_001155227.1.44445 WP_001155227.1.44447 WP_001155227.1.4445 WP_001155227.1.44452 WP_001155227.1.44458 WP_001155227.1.44460 WP_001155227.1.44461 WP_001155227.1.44488 WP_001155227.1.4449 WP_001155227.1.44524 WP_001155227.1.44539 WP_001155227.1.4454 WP_001155227.1.44558 WP_001155227.1.44561 WP_001155227.1.44570 WP_001155227.1.44587 WP_001155227.1.4459 WP_001155227.1.44608 WP_001155227.1.44610 WP_001155227.1.44622 WP_001155227.1.44627 WP_001155227.1.4463 WP_001155227.1.44642 WP_001155227.1.44649 WP_001155227.1.44661 WP_001155227.1.44668 WP_001155227.1.44671 WP_001155227.1.44686 WP_001155227.1.4471 WP_001155227.1.44717 WP_001155227.1.44724 WP_001155227.1.4473 WP_001155227.1.44733 WP_001155227.1.44756 WP_001155227.1.44759 WP_001155227.1.44784 WP_001155227.1.448 WP_001155227.1.44800 WP_001155227.1.44814 WP_001155227.1.44818 WP_001155227.1.44821 WP_001155227.1.44836 WP_001155227.1.44840 WP_001155227.1.44841 WP_001155227.1.44843 WP_001155227.1.44848 WP_001155227.1.44849 WP_001155227.1.44854 WP_001155227.1.44855 WP_001155227.1.44857 WP_001155227.1.44906 WP_001155227.1.44923 WP_001155227.1.44954 WP_001155227.1.44960 WP_001155227.1.44961 WP_001155227.1.44970 WP_001155227.1.44975 WP_001155227.1.44977 WP_001155227.1.44980 WP_001155227.1.45000 WP_001155227.1.45020 WP_001155227.1.45025 WP_001155227.1.45028 WP_001155227.1.45043 WP_001155227.1.45053 WP_001155227.1.45068 WP_001155227.1.45076 WP_001155227.1.45104 WP_001155227.1.45116 WP_001155227.1.4515 WP_001155227.1.45153 WP_001155227.1.45156 WP_001155227.1.4516 WP_001155227.1.45190 WP_001155227.1.45195 WP_001155227.1.45208 WP_001155227.1.4524 WP_001155227.1.45246 WP_001155227.1.45293 WP_001155227.1.4530 WP_001155227.1.45301 WP_001155227.1.45313 WP_001155227.1.45329 WP_001155227.1.4535 WP_001155227.1.45359 WP_001155227.1.4538 WP_001155227.1.45392 WP_001155227.1.45404 WP_001155227.1.45405 WP_001155227.1.4541 WP_001155227.1.45413 WP_001155227.1.45444 WP_001155227.1.45486 WP_001155227.1.4549 WP_001155227.1.45494 WP_001155227.1.45500 WP_001155227.1.45525 WP_001155227.1.45536 WP_001155227.1.45538 WP_001155227.1.45565 WP_001155227.1.45575 WP_001155227.1.45581 WP_001155227.1.45595 WP_001155227.1.45600 WP_001155227.1.45627 WP_001155227.1.4563 WP_001155227.1.45664 WP_001155227.1.45674 WP_001155227.1.45676 WP_001155227.1.4570 WP_001155227.1.45707 WP_001155227.1.45718 WP_001155227.1.4574 WP_001155227.1.45740 WP_001155227.1.45741 WP_001155227.1.45752 WP_001155227.1.4576 WP_001155227.1.45774 WP_001155227.1.45789 WP_001155227.1.45793 WP_001155227.1.45799 WP_001155227.1.45801 WP_001155227.1.45806 WP_001155227.1.4583 WP_001155227.1.45840 WP_001155227.1.45841 WP_001155227.1.45846 WP_001155227.1.45865 WP_001155227.1.45868 WP_001155227.1.45891 WP_001155227.1.45901 WP_001155227.1.45921 WP_001155227.1.4593 WP_001155227.1.45930 WP_001155227.1.45931 WP_001155227.1.45933 WP_001155227.1.45941 WP_001155227.1.45945 WP_001155227.1.45949 WP_001155227.1.45960 WP_001155227.1.45962 WP_001155227.1.45968 WP_001155227.1.45990 WP_001155227.1.45991 WP_001155227.1.4600 WP_001155227.1.46016 WP_001155227.1.46026 WP_001155227.1.46027 WP_001155227.1.46039 WP_001155227.1.46048 WP_001155227.1.46049 WP_001155227.1.46070 WP_001155227.1.46097 WP_001155227.1.4610 WP_001155227.1.46115 WP_001155227.1.46122 WP_001155227.1.4613 WP_001155227.1.46164 WP_001155227.1.4617 WP_001155227.1.46181 WP_001155227.1.46186 WP_001155227.1.4619 WP_001155227.1.46197 WP_001155227.1.46213 WP_001155227.1.46217 WP_001155227.1.4622 WP_001155227.1.46239 WP_001155227.1.46245 WP_001155227.1.46257 WP_001155227.1.46263 WP_001155227.1.46282 WP_001155227.1.46283 WP_001155227.1.46291 WP_001155227.1.46301 WP_001155227.1.46325 WP_001155227.1.46329 WP_001155227.1.46369 WP_001155227.1.46378 WP_001155227.1.46379 WP_001155227.1.46414 WP_001155227.1.46429 WP_001155227.1.4643 WP_001155227.1.46433 WP_001155227.1.46438 WP_001155227.1.46441 WP_001155227.1.46451 WP_001155227.1.4646 WP_001155227.1.46468 WP_001155227.1.4647 WP_001155227.1.46477 WP_001155227.1.46487 WP_001155227.1.46503 WP_001155227.1.46526 WP_001155227.1.46531 WP_001155227.1.46541 WP_001155227.1.46552 WP_001155227.1.46555 WP_001155227.1.46573 WP_001155227.1.46582 WP_001155227.1.46589 WP_001155227.1.46594 WP_001155227.1.46597 WP_001155227.1.46602 WP_001155227.1.46611 WP_001155227.1.46614 WP_001155227.1.46616 WP_001155227.1.46626 WP_001155227.1.46643 WP_001155227.1.46655 WP_001155227.1.46668 WP_001155227.1.4670 WP_001155227.1.46734 WP_001155227.1.46743 WP_001155227.1.46795 WP_001155227.1.46798 WP_001155227.1.46802 WP_001155227.1.46806 WP_001155227.1.46810 WP_001155227.1.46820 WP_001155227.1.46821 WP_001155227.1.46832 WP_001155227.1.46833 WP_001155227.1.46841 WP_001155227.1.46857 WP_001155227.1.46860 WP_001155227.1.46876 WP_001155227.1.46882 WP_001155227.1.46898 WP_001155227.1.46909 WP_001155227.1.4691 WP_001155227.1.46912 WP_001155227.1.46913 WP_001155227.1.46932 WP_001155227.1.4695 WP_001155227.1.46990 WP_001155227.1.46991 WP_001155227.1.46994 WP_001155227.1.46999 WP_001155227.1.47024 WP_001155227.1.47028 WP_001155227.1.47029 WP_001155227.1.47030 WP_001155227.1.47034 WP_001155227.1.47038 WP_001155227.1.47039 WP_001155227.1.47047 WP_001155227.1.47048 WP_001155227.1.47050 WP_001155227.1.47054 WP_001155227.1.47063 WP_001155227.1.47069 WP_001155227.1.47073 WP_001155227.1.4708 WP_001155227.1.47124 WP_001155227.1.47140 WP_001155227.1.47156 WP_001155227.1.47167 WP_001155227.1.47171 WP_001155227.1.47186 WP_001155227.1.47189 WP_001155227.1.47197 WP_001155227.1.47198 WP_001155227.1.4722 WP_001155227.1.47224 WP_001155227.1.4723 WP_001155227.1.47235 WP_001155227.1.47246 WP_001155227.1.47247 WP_001155227.1.4725 WP_001155227.1.47280 WP_001155227.1.47307 WP_001155227.1.47316 WP_001155227.1.47319 WP_001155227.1.47322 WP_001155227.1.47332 WP_001155227.1.47344 WP_001155227.1.47349 WP_001155227.1.47350 WP_001155227.1.47356 WP_001155227.1.47363 WP_001155227.1.47366 WP_001155227.1.47370 WP_001155227.1.47386 WP_001155227.1.47398 WP_001155227.1.4740 WP_001155227.1.47401 WP_001155227.1.47411 WP_001155227.1.47414 WP_001155227.1.47416 WP_001155227.1.47425 WP_001155227.1.4743 WP_001155227.1.47451 WP_001155227.1.47454 WP_001155227.1.47464 WP_001155227.1.47473 WP_001155227.1.47477 WP_001155227.1.47488 WP_001155227.1.47496 WP_001155227.1.47498 WP_001155227.1.47500 WP_001155227.1.47529 WP_001155227.1.47533 WP_001155227.1.47546 WP_001155227.1.47555 WP_001155227.1.47582 WP_001155227.1.47599 WP_001155227.1.47634 WP_001155227.1.47646 WP_001155227.1.47647 WP_001155227.1.47654 WP_001155227.1.47662 WP_001155227.1.47673 WP_001155227.1.47709 WP_001155227.1.4772 WP_001155227.1.47722 WP_001155227.1.4773 WP_001155227.1.47734 WP_001155227.1.47740 WP_001155227.1.47744 WP_001155227.1.47761 WP_001155227.1.47764 WP_001155227.1.47765 WP_001155227.1.47770 WP_001155227.1.47775 WP_001155227.1.47784 WP_001155227.1.47790 WP_001155227.1.47791 WP_001155227.1.47820 WP_001155227.1.47827 WP_001155227.1.4783 WP_001155227.1.47837 WP_001155227.1.47848 WP_001155227.1.4785 WP_001155227.1.47884 WP_001155227.1.47914 WP_001155227.1.47935 WP_001155227.1.47954 WP_001155227.1.4796 WP_001155227.1.47962 WP_001155227.1.47976 WP_001155227.1.47981 WP_001155227.1.47983 WP_001155227.1.47994 WP_001155227.1.48000 WP_001155227.1.48018 WP_001155227.1.48029 WP_001155227.1.48040 WP_001155227.1.48048 WP_001155227.1.48051 WP_001155227.1.48065 WP_001155227.1.48073 WP_001155227.1.48077 WP_001155227.1.48080 WP_001155227.1.48087 WP_001155227.1.48090 WP_001155227.1.48096 WP_001155227.1.4811 WP_001155227.1.48111 WP_001155227.1.4812 WP_001155227.1.48121 WP_001155227.1.48144 WP_001155227.1.48168 WP_001155227.1.48176 WP_001155227.1.48188 WP_001155227.1.48194 WP_001155227.1.48200 WP_001155227.1.48203 WP_001155227.1.48216 WP_001155227.1.48222 WP_001155227.1.48226 WP_001155227.1.48229 WP_001155227.1.48258 WP_001155227.1.4826 WP_001155227.1.48265 WP_001155227.1.48285 WP_001155227.1.48290 WP_001155227.1.48291 WP_001155227.1.48317 WP_001155227.1.48353 WP_001155227.1.48355 WP_001155227.1.48371 WP_001155227.1.48385 WP_001155227.1.48404 WP_001155227.1.48417 WP_001155227.1.48421 WP_001155227.1.48431 WP_001155227.1.48433 WP_001155227.1.48469 WP_001155227.1.48477 WP_001155227.1.48480 WP_001155227.1.48483 WP_001155227.1.48505 WP_001155227.1.48522 WP_001155227.1.48528 WP_001155227.1.48540 WP_001155227.1.4857 WP_001155227.1.48571 WP_001155227.1.48590 WP_001155227.1.486 WP_001155227.1.48602 WP_001155227.1.48615 WP_001155227.1.48620 WP_001155227.1.48626 WP_001155227.1.48629 WP_001155227.1.48678 WP_001155227.1.48689 WP_001155227.1.48695 WP_001155227.1.48697 WP_001155227.1.4870 WP_001155227.1.4871 WP_001155227.1.48712 WP_001155227.1.4876 WP_001155227.1.48771 WP_001155227.1.48792 WP_001155227.1.48801 WP_001155227.1.48806 WP_001155227.1.48808 WP_001155227.1.48825 WP_001155227.1.48827 WP_001155227.1.48847 WP_001155227.1.48860 WP_001155227.1.48882 WP_001155227.1.48901 WP_001155227.1.48902 WP_001155227.1.48907 WP_001155227.1.48910 WP_001155227.1.4892 WP_001155227.1.48921 WP_001155227.1.48926 WP_001155227.1.48928 WP_001155227.1.48953 WP_001155227.1.48954 WP_001155227.1.48970 WP_001155227.1.48974 WP_001155227.1.49001 WP_001155227.1.49002 WP_001155227.1.49009 WP_001155227.1.49061 WP_001155227.1.49076 WP_001155227.1.49104 WP_001155227.1.49107 WP_001155227.1.49124 WP_001155227.1.49136 WP_001155227.1.49141 WP_001155227.1.49147 WP_001155227.1.49170 WP_001155227.1.49179 WP_001155227.1.49190 WP_001155227.1.49229 WP_001155227.1.49236 WP_001155227.1.49243 WP_001155227.1.49258 WP_001155227.1.49259 WP_001155227.1.49275 WP_001155227.1.4931 WP_001155227.1.49312 WP_001155227.1.49321 WP_001155227.1.49332 WP_001155227.1.49336 WP_001155227.1.49338 WP_001155227.1.49342 WP_001155227.1.49347 WP_001155227.1.49363 WP_001155227.1.49376 WP_001155227.1.49393 WP_001155227.1.49401 WP_001155227.1.49412 WP_001155227.1.49431 WP_001155227.1.49446 WP_001155227.1.49459 WP_001155227.1.49464 WP_001155227.1.49481 WP_001155227.1.49482 WP_001155227.1.49483 WP_001155227.1.4949 WP_001155227.1.49496 WP_001155227.1.49521 WP_001155227.1.49522 WP_001155227.1.49528 WP_001155227.1.4953 WP_001155227.1.49531 WP_001155227.1.49537 WP_001155227.1.49546 WP_001155227.1.49554 WP_001155227.1.49558 WP_001155227.1.49567 WP_001155227.1.49594 WP_001155227.1.49599 WP_001155227.1.49615 WP_001155227.1.49621 WP_001155227.1.49625 WP_001155227.1.49645 WP_001155227.1.49655 WP_001155227.1.49661 WP_001155227.1.49662 WP_001155227.1.49675 WP_001155227.1.49684 WP_001155227.1.49712 WP_001155227.1.49722 WP_001155227.1.49733 WP_001155227.1.49740 WP_001155227.1.49747 WP_001155227.1.49768 WP_001155227.1.49771 WP_001155227.1.49774 WP_001155227.1.49777 WP_001155227.1.49783 WP_001155227.1.49788 WP_001155227.1.49794 WP_001155227.1.49820 WP_001155227.1.49823 WP_001155227.1.4985 WP_001155227.1.49856 WP_001155227.1.49861 WP_001155227.1.49879 WP_001155227.1.49883 WP_001155227.1.49884 WP_001155227.1.49900 WP_001155227.1.49902 WP_001155227.1.49941 WP_001155227.1.4995 WP_001155227.1.49950 WP_001155227.1.49954 WP_001155227.1.49972 WP_001155227.1.49987 WP_001155227.1.50006 WP_001155227.1.50008 WP_001155227.1.5003 WP_001155227.1.50036 WP_001155227.1.50056 WP_001155227.1.50058 WP_001155227.1.50078 WP_001155227.1.50098 WP_001155227.1.50110 WP_001155227.1.50113 WP_001155227.1.50119 WP_001155227.1.50136 WP_001155227.1.50146 WP_001155227.1.5017 WP_001155227.1.50179 WP_001155227.1.50182 WP_001155227.1.50187 WP_001155227.1.50191 WP_001155227.1.50196 WP_001155227.1.50207 WP_001155227.1.50214 WP_001155227.1.50228 WP_001155227.1.50230 WP_001155227.1.50258 WP_001155227.1.50262 WP_001155227.1.50266 WP_001155227.1.50269 WP_001155227.1.50270 WP_001155227.1.50273 WP_001155227.1.50278 WP_001155227.1.50304 WP_001155227.1.50345 WP_001155227.1.50353 WP_001155227.1.50354 WP_001155227.1.50358 WP_001155227.1.50361 WP_001155227.1.50366 WP_001155227.1.5037 WP_001155227.1.50380 WP_001155227.1.50381 WP_001155227.1.5040 WP_001155227.1.5041 WP_001155227.1.50412 WP_001155227.1.50418 WP_001155227.1.50427 WP_001155227.1.50452 WP_001155227.1.5046 WP_001155227.1.50539 WP_001155227.1.50548 WP_001155227.1.50549 WP_001155227.1.5056 WP_001155227.1.50564 WP_001155227.1.50579 WP_001155227.1.50585 WP_001155227.1.50586 WP_001155227.1.506 WP_001155227.1.50608 WP_001155227.1.5061 WP_001155227.1.50616 WP_001155227.1.50627 WP_001155227.1.5064 WP_001155227.1.5067 WP_001155227.1.50690 WP_001155227.1.50700 WP_001155227.1.50715 WP_001155227.1.50717 WP_001155227.1.50725 WP_001155227.1.50728 WP_001155227.1.50762 WP_001155227.1.5082 WP_001155227.1.50864 WP_001155227.1.50887 WP_001155227.1.50925 WP_001155227.1.50936 WP_001155227.1.50939 WP_001155227.1.50947 WP_001155227.1.5095 WP_001155227.1.50957 WP_001155227.1.50969 WP_001155227.1.50986 WP_001155227.1.50988 WP_001155227.1.50990 WP_001155227.1.50993 WP_001155227.1.50996 WP_001155227.1.51013 WP_001155227.1.51027 WP_001155227.1.51042 WP_001155227.1.51058 WP_001155227.1.5106 WP_001155227.1.511 WP_001155227.1.51127 WP_001155227.1.51154 WP_001155227.1.51170 WP_001155227.1.51171 WP_001155227.1.51172 WP_001155227.1.51175 WP_001155227.1.51180 WP_001155227.1.51190 WP_001155227.1.51201 WP_001155227.1.51203 WP_001155227.1.51206 WP_001155227.1.51211 WP_001155227.1.5124 WP_001155227.1.51248 WP_001155227.1.51253 WP_001155227.1.51255 WP_001155227.1.51260 WP_001155227.1.51278 WP_001155227.1.5128 WP_001155227.1.51283 WP_001155227.1.51299 WP_001155227.1.51300 WP_001155227.1.51307 WP_001155227.1.51323 WP_001155227.1.51330 WP_001155227.1.51336 WP_001155227.1.51354 WP_001155227.1.51360 WP_001155227.1.51380 WP_001155227.1.51392 WP_001155227.1.51405 WP_001155227.1.51425 WP_001155227.1.51426 WP_001155227.1.51427 WP_001155227.1.51430 WP_001155227.1.51441 WP_001155227.1.5146 WP_001155227.1.51462 WP_001155227.1.51482 WP_001155227.1.51490 WP_001155227.1.51495 WP_001155227.1.51503 WP_001155227.1.51505 WP_001155227.1.51513 WP_001155227.1.51525 WP_001155227.1.5153 WP_001155227.1.51537 WP_001155227.1.51539 WP_001155227.1.51542 WP_001155227.1.51548 WP_001155227.1.51552 WP_001155227.1.5157 WP_001155227.1.5158 WP_001155227.1.51580 WP_001155227.1.51587 WP_001155227.1.51596 WP_001155227.1.51600 WP_001155227.1.51607 WP_001155227.1.51624 WP_001155227.1.51629 WP_001155227.1.51643 WP_001155227.1.51662 WP_001155227.1.51690 WP_001155227.1.51693 WP_001155227.1.51707 WP_001155227.1.51718 WP_001155227.1.5172 WP_001155227.1.51736 WP_001155227.1.51757 WP_001155227.1.51760 WP_001155227.1.51784 WP_001155227.1.518 WP_001155227.1.51804 WP_001155227.1.51834 WP_001155227.1.51837 WP_001155227.1.51839 WP_001155227.1.51869 WP_001155227.1.51873 WP_001155227.1.51881 WP_001155227.1.51896 WP_001155227.1.51899 WP_001155227.1.51906 WP_001155227.1.51944 WP_001155227.1.51949 WP_001155227.1.51968 WP_001155227.1.51979 WP_001155227.1.51985 WP_001155227.1.51988 WP_001155227.1.5199 WP_001155227.1.51998 WP_001155227.1.51999 WP_001155227.1.52011 WP_001155227.1.52020 WP_001155227.1.52039 WP_001155227.1.52044 WP_001155227.1.52048 WP_001155227.1.52062 WP_001155227.1.52076 WP_001155227.1.52085 WP_001155227.1.52098 WP_001155227.1.52111 WP_001155227.1.52126 WP_001155227.1.52127 WP_001155227.1.52135 WP_001155227.1.52137 WP_001155227.1.5217 WP_001155227.1.52171 WP_001155227.1.52186 WP_001155227.1.52200 WP_001155227.1.52211 WP_001155227.1.52213 WP_001155227.1.52214 WP_001155227.1.52225 WP_001155227.1.52230 WP_001155227.1.52236 WP_001155227.1.52240 WP_001155227.1.52243 WP_001155227.1.52249 WP_001155227.1.52257 WP_001155227.1.52258 WP_001155227.1.5227 WP_001155227.1.52270 WP_001155227.1.52271 WP_001155227.1.52272 WP_001155227.1.52299 WP_001155227.1.52304 WP_001155227.1.52305 WP_001155227.1.52313 WP_001155227.1.52324 WP_001155227.1.52328 WP_001155227.1.52333 WP_001155227.1.52363 WP_001155227.1.52367 WP_001155227.1.52378 WP_001155227.1.5239 WP_001155227.1.52399 WP_001155227.1.52406 WP_001155227.1.52413 WP_001155227.1.52419 WP_001155227.1.52421 WP_001155227.1.52492 WP_001155227.1.52496 WP_001155227.1.52524 WP_001155227.1.52542 WP_001155227.1.52543 WP_001155227.1.52544 WP_001155227.1.52554 WP_001155227.1.52558 WP_001155227.1.52567 WP_001155227.1.52568 WP_001155227.1.52601 WP_001155227.1.52612 WP_001155227.1.52631 WP_001155227.1.5265 WP_001155227.1.5266 WP_001155227.1.52662 WP_001155227.1.52691 WP_001155227.1.52704 WP_001155227.1.52710 WP_001155227.1.5272 WP_001155227.1.52735 WP_001155227.1.52755 WP_001155227.1.52762 WP_001155227.1.52771 WP_001155227.1.52774 WP_001155227.1.52777 WP_001155227.1.52780 WP_001155227.1.52781 WP_001155227.1.52801 WP_001155227.1.52804 WP_001155227.1.52844 WP_001155227.1.52846 WP_001155227.1.5285 WP_001155227.1.52852 WP_001155227.1.52853 WP_001155227.1.52855 WP_001155227.1.52881 WP_001155227.1.52883 WP_001155227.1.52895 WP_001155227.1.52908 WP_001155227.1.5291 WP_001155227.1.52913 WP_001155227.1.52933 WP_001155227.1.52942 WP_001155227.1.52945 WP_001155227.1.52962 WP_001155227.1.52995 WP_001155227.1.52996 WP_001155227.1.53012 WP_001155227.1.53020 WP_001155227.1.53021 WP_001155227.1.53027 WP_001155227.1.53084 WP_001155227.1.53095 WP_001155227.1.53099 WP_001155227.1.5310 WP_001155227.1.53110 WP_001155227.1.53123 WP_001155227.1.53155 WP_001155227.1.53162 WP_001155227.1.53181 WP_001155227.1.53186 WP_001155227.1.532 WP_001155227.1.53211 WP_001155227.1.5322 WP_001155227.1.53223 WP_001155227.1.53228 WP_001155227.1.53238 WP_001155227.1.53242 WP_001155227.1.53244 WP_001155227.1.53251 WP_001155227.1.53252 WP_001155227.1.53262 WP_001155227.1.53270 WP_001155227.1.53277 WP_001155227.1.53308 WP_001155227.1.53327 WP_001155227.1.53356 WP_001155227.1.53360 WP_001155227.1.53364 WP_001155227.1.53377 WP_001155227.1.53401 WP_001155227.1.53410 WP_001155227.1.53415 WP_001155227.1.53419 WP_001155227.1.5342 WP_001155227.1.53428 WP_001155227.1.53431 WP_001155227.1.53482 WP_001155227.1.53505 WP_001155227.1.5351 WP_001155227.1.53535 WP_001155227.1.53537 WP_001155227.1.53545 WP_001155227.1.53556 WP_001155227.1.53557 WP_001155227.1.53574 WP_001155227.1.53587 WP_001155227.1.53589 WP_001155227.1.53590 WP_001155227.1.53592 WP_001155227.1.53594 WP_001155227.1.53601 WP_001155227.1.5362 WP_001155227.1.53642 WP_001155227.1.53645 WP_001155227.1.53649 WP_001155227.1.53687 WP_001155227.1.53690 WP_001155227.1.53693 WP_001155227.1.53706 WP_001155227.1.5375 WP_001155227.1.53769 WP_001155227.1.53809 WP_001155227.1.53810 WP_001155227.1.53811 WP_001155227.1.53841 WP_001155227.1.53845 WP_001155227.1.53863 WP_001155227.1.53866 WP_001155227.1.53878 WP_001155227.1.53884 WP_001155227.1.5391 WP_001155227.1.5393 WP_001155227.1.53931 WP_001155227.1.53940 WP_001155227.1.5395 WP_001155227.1.53966 WP_001155227.1.53968 WP_001155227.1.53972 WP_001155227.1.53978 WP_001155227.1.53991 WP_001155227.1.53994 WP_001155227.1.54002 WP_001155227.1.54013 WP_001155227.1.54023 WP_001155227.1.54024 WP_001155227.1.54028 WP_001155227.1.54032 WP_001155227.1.54051 WP_001155227.1.54072 WP_001155227.1.54091 WP_001155227.1.54095 WP_001155227.1.54102 WP_001155227.1.54104 WP_001155227.1.54144 WP_001155227.1.54169 WP_001155227.1.54185 WP_001155227.1.54188 WP_001155227.1.54202 WP_001155227.1.54208 WP_001155227.1.54213 WP_001155227.1.54263 WP_001155227.1.54307 WP_001155227.1.54313 WP_001155227.1.54317 WP_001155227.1.54328 WP_001155227.1.54329 WP_001155227.1.5433 WP_001155227.1.5434 WP_001155227.1.54344 WP_001155227.1.54359 WP_001155227.1.54388 WP_001155227.1.54394 WP_001155227.1.5440 WP_001155227.1.5441 WP_001155227.1.54411 WP_001155227.1.54417 WP_001155227.1.54418 WP_001155227.1.54429 WP_001155227.1.54439 WP_001155227.1.54454 WP_001155227.1.54463 WP_001155227.1.54476 WP_001155227.1.54507 WP_001155227.1.54524 WP_001155227.1.54534 WP_001155227.1.54546 WP_001155227.1.54585 WP_001155227.1.54590 WP_001155227.1.54591 WP_001155227.1.5460 WP_001155227.1.54601 WP_001155227.1.54602 WP_001155227.1.54605 WP_001155227.1.5461 WP_001155227.1.54614 WP_001155227.1.54620 WP_001155227.1.54625 WP_001155227.1.54638 WP_001155227.1.54641 WP_001155227.1.54643 WP_001155227.1.5467 WP_001155227.1.54688 WP_001155227.1.54695 WP_001155227.1.5470 WP_001155227.1.54708 WP_001155227.1.54721 WP_001155227.1.54725 WP_001155227.1.54729 WP_001155227.1.54754 WP_001155227.1.54755 WP_001155227.1.54760 WP_001155227.1.54769 WP_001155227.1.5478 WP_001155227.1.5479 WP_001155227.1.54798 WP_001155227.1.54817 WP_001155227.1.54829 WP_001155227.1.5486 WP_001155227.1.54861 WP_001155227.1.54875 WP_001155227.1.54883 WP_001155227.1.54918 WP_001155227.1.54921 WP_001155227.1.54927 WP_001155227.1.54940 WP_001155227.1.54941 WP_001155227.1.54946 WP_001155227.1.54972 WP_001155227.1.54981 WP_001155227.1.54989 WP_001155227.1.54991 WP_001155227.1.54993 WP_001155227.1.55003 WP_001155227.1.55005 WP_001155227.1.55009 WP_001155227.1.55041 WP_001155227.1.55070 WP_001155227.1.55112 WP_001155227.1.55115 WP_001155227.1.5512 WP_001155227.1.55123 WP_001155227.1.55134 WP_001155227.1.55144 WP_001155227.1.55149 WP_001155227.1.55151 WP_001155227.1.55177 WP_001155227.1.55179 WP_001155227.1.55185 WP_001155227.1.55197 WP_001155227.1.5520 WP_001155227.1.55203 WP_001155227.1.55218 WP_001155227.1.55222 WP_001155227.1.55226 WP_001155227.1.55273 WP_001155227.1.55275 WP_001155227.1.55286 WP_001155227.1.55291 WP_001155227.1.55338 WP_001155227.1.55342 WP_001155227.1.55357 WP_001155227.1.55359 WP_001155227.1.55374 WP_001155227.1.55381 WP_001155227.1.55414 WP_001155227.1.55417 WP_001155227.1.55420 WP_001155227.1.55424 WP_001155227.1.55425 WP_001155227.1.5546 WP_001155227.1.55466 WP_001155227.1.55472 WP_001155227.1.55482 WP_001155227.1.55483 WP_001155227.1.55489 WP_001155227.1.55492 WP_001155227.1.55507 WP_001155227.1.55529 WP_001155227.1.55550 WP_001155227.1.55551 WP_001155227.1.55552 WP_001155227.1.55556 WP_001155227.1.55560 WP_001155227.1.55563 WP_001155227.1.55571 WP_001155227.1.55574 WP_001155227.1.55581 WP_001155227.1.55597 WP_001155227.1.55608 WP_001155227.1.5561 WP_001155227.1.55629 WP_001155227.1.5566 WP_001155227.1.55676 WP_001155227.1.5570 WP_001155227.1.55709 WP_001155227.1.55720 WP_001155227.1.55727 WP_001155227.1.55730 WP_001155227.1.55731 WP_001155227.1.55744 WP_001155227.1.55757 WP_001155227.1.55787 WP_001155227.1.55790 WP_001155227.1.55791 WP_001155227.1.55808 WP_001155227.1.55820 WP_001155227.1.55825 WP_001155227.1.55838 WP_001155227.1.55844 WP_001155227.1.55868 WP_001155227.1.55870 WP_001155227.1.55888 WP_001155227.1.55892 WP_001155227.1.55896 WP_001155227.1.55897 WP_001155227.1.55936 WP_001155227.1.55979 WP_001155227.1.55981 WP_001155227.1.55988 WP_001155227.1.55990 WP_001155227.1.56033 WP_001155227.1.56040 WP_001155227.1.56047 WP_001155227.1.56053 WP_001155227.1.56072 WP_001155227.1.561 WP_001155227.1.56101 WP_001155227.1.56122 WP_001155227.1.56139 WP_001155227.1.5614 WP_001155227.1.56142 WP_001155227.1.56149 WP_001155227.1.56151 WP_001155227.1.5616 WP_001155227.1.56164 WP_001155227.1.56169 WP_001155227.1.56177 WP_001155227.1.56193 WP_001155227.1.56197 WP_001155227.1.562 WP_001155227.1.56216 WP_001155227.1.56231 WP_001155227.1.56278 WP_001155227.1.56285 WP_001155227.1.56293 WP_001155227.1.56302 WP_001155227.1.5632 WP_001155227.1.56338 WP_001155227.1.56345 WP_001155227.1.56358 WP_001155227.1.56371 WP_001155227.1.56388 WP_001155227.1.5639 WP_001155227.1.56390 WP_001155227.1.56392 WP_001155227.1.56399 WP_001155227.1.56402 WP_001155227.1.56436 WP_001155227.1.56439 WP_001155227.1.56446 WP_001155227.1.56457 WP_001155227.1.5646 WP_001155227.1.56469 WP_001155227.1.56481 WP_001155227.1.56489 WP_001155227.1.5649 WP_001155227.1.56491 WP_001155227.1.56501 WP_001155227.1.56502 WP_001155227.1.56513 WP_001155227.1.56523 WP_001155227.1.56528 WP_001155227.1.56543 WP_001155227.1.56554 WP_001155227.1.56561 WP_001155227.1.56571 WP_001155227.1.56573 WP_001155227.1.56586 WP_001155227.1.56650 WP_001155227.1.56662 WP_001155227.1.56665 WP_001155227.1.56680 WP_001155227.1.56689 WP_001155227.1.5670 WP_001155227.1.56704 WP_001155227.1.56713 WP_001155227.1.56714 WP_001155227.1.56721 WP_001155227.1.56742 WP_001155227.1.56776 WP_001155227.1.56777 WP_001155227.1.56786 WP_001155227.1.56787 WP_001155227.1.56789 WP_001155227.1.56799 WP_001155227.1.56821 WP_001155227.1.56830 WP_001155227.1.56835 WP_001155227.1.56846 WP_001155227.1.5685 WP_001155227.1.56871 WP_001155227.1.56882 WP_001155227.1.56885 WP_001155227.1.56908 WP_001155227.1.56932 WP_001155227.1.56933 WP_001155227.1.56934 WP_001155227.1.56936 WP_001155227.1.56937 WP_001155227.1.56941 WP_001155227.1.56951 WP_001155227.1.56978 WP_001155227.1.56980 WP_001155227.1.56992 WP_001155227.1.57011 WP_001155227.1.57032 WP_001155227.1.57045 WP_001155227.1.57051 WP_001155227.1.57068 WP_001155227.1.57071 WP_001155227.1.57072 WP_001155227.1.57079 WP_001155227.1.57086 WP_001155227.1.57100 WP_001155227.1.57124 WP_001155227.1.57150 WP_001155227.1.57159 WP_001155227.1.57180 WP_001155227.1.57181 WP_001155227.1.57182 WP_001155227.1.57185 WP_001155227.1.57197 WP_001155227.1.57202 WP_001155227.1.57213 WP_001155227.1.57216 WP_001155227.1.57222 WP_001155227.1.57254 WP_001155227.1.57266 WP_001155227.1.57269 WP_001155227.1.57278 WP_001155227.1.57280 WP_001155227.1.57281 WP_001155227.1.57319 WP_001155227.1.57348 WP_001155227.1.57349 WP_001155227.1.57355 WP_001155227.1.57386 WP_001155227.1.57395 WP_001155227.1.57401 WP_001155227.1.57403 WP_001155227.1.57410 WP_001155227.1.57414 WP_001155227.1.5742 WP_001155227.1.57432 WP_001155227.1.57438 WP_001155227.1.57451 WP_001155227.1.57453 WP_001155227.1.57466 WP_001155227.1.5748 WP_001155227.1.57487 WP_001155227.1.57492 WP_001155227.1.57517 WP_001155227.1.57538 WP_001155227.1.57539 WP_001155227.1.5755 WP_001155227.1.57550 WP_001155227.1.57558 WP_001155227.1.57574 WP_001155227.1.57588 WP_001155227.1.57608 WP_001155227.1.57610 WP_001155227.1.57628 WP_001155227.1.57629 WP_001155227.1.57634 WP_001155227.1.57638 WP_001155227.1.5764 WP_001155227.1.57646 WP_001155227.1.57659 WP_001155227.1.57663 WP_001155227.1.57669 WP_001155227.1.57719 WP_001155227.1.57738 WP_001155227.1.57812 WP_001155227.1.57814 WP_001155227.1.57820 WP_001155227.1.57832 WP_001155227.1.57836 WP_001155227.1.57846 WP_001155227.1.57851 WP_001155227.1.57854 WP_001155227.1.5786 WP_001155227.1.5787 WP_001155227.1.57898 WP_001155227.1.57903 WP_001155227.1.57904 WP_001155227.1.57920 WP_001155227.1.57951 WP_001155227.1.57975 WP_001155227.1.57982 WP_001155227.1.57983 WP_001155227.1.57994 WP_001155227.1.58001 WP_001155227.1.58009 WP_001155227.1.58022 WP_001155227.1.58038 WP_001155227.1.58045 WP_001155227.1.58048 WP_001155227.1.58057 WP_001155227.1.58060 WP_001155227.1.58080 WP_001155227.1.58092 WP_001155227.1.58094 WP_001155227.1.58097 WP_001155227.1.58098 WP_001155227.1.5810 WP_001155227.1.58107 WP_001155227.1.5812 WP_001155227.1.58136 WP_001155227.1.58143 WP_001155227.1.58146 WP_001155227.1.58163 WP_001155227.1.58169 WP_001155227.1.58172 WP_001155227.1.58180 WP_001155227.1.58206 WP_001155227.1.58226 WP_001155227.1.58232 WP_001155227.1.58233 WP_001155227.1.58238 WP_001155227.1.58244 WP_001155227.1.58248 WP_001155227.1.58258 WP_001155227.1.58267 WP_001155227.1.58289 WP_001155227.1.58292 WP_001155227.1.58316 WP_001155227.1.58336 WP_001155227.1.58340 WP_001155227.1.58345 WP_001155227.1.58368 WP_001155227.1.58371 WP_001155227.1.58384 WP_001155227.1.584 WP_001155227.1.58401 WP_001155227.1.58408 WP_001155227.1.58414 WP_001155227.1.5842 WP_001155227.1.58420 WP_001155227.1.58423 WP_001155227.1.58424 WP_001155227.1.58429 WP_001155227.1.58440 WP_001155227.1.58444 WP_001155227.1.58445 WP_001155227.1.58449 WP_001155227.1.58459 WP_001155227.1.58475 WP_001155227.1.58493 WP_001155227.1.58496 WP_001155227.1.585 WP_001155227.1.58507 WP_001155227.1.58514 WP_001155227.1.5852 WP_001155227.1.58528 WP_001155227.1.58547 WP_001155227.1.58552 WP_001155227.1.58560 WP_001155227.1.58572 WP_001155227.1.58582 WP_001155227.1.58609 WP_001155227.1.58617 WP_001155227.1.58622 WP_001155227.1.58657 WP_001155227.1.58680 WP_001155227.1.58692 WP_001155227.1.58705 WP_001155227.1.58707 WP_001155227.1.58723 WP_001155227.1.58737 WP_001155227.1.58799 WP_001155227.1.58837 WP_001155227.1.58867 WP_001155227.1.58870 WP_001155227.1.58901 WP_001155227.1.58940 WP_001155227.1.58942 WP_001155227.1.58951 WP_001155227.1.58958 WP_001155227.1.58976 WP_001155227.1.58977 WP_001155227.1.58983 WP_001155227.1.58999 WP_001155227.1.59024 WP_001155227.1.59026 WP_001155227.1.59035 WP_001155227.1.59038 WP_001155227.1.59055 WP_001155227.1.5906 WP_001155227.1.59060 WP_001155227.1.59073 WP_001155227.1.59083 WP_001155227.1.59119 WP_001155227.1.59165 WP_001155227.1.59174 WP_001155227.1.59190 WP_001155227.1.59199 WP_001155227.1.59218 WP_001155227.1.59226 WP_001155227.1.59263 WP_001155227.1.5927 WP_001155227.1.59280 WP_001155227.1.59291 WP_001155227.1.59292 WP_001155227.1.59293 WP_001155227.1.59302 WP_001155227.1.59306 WP_001155227.1.59359 WP_001155227.1.59374 WP_001155227.1.59395 WP_001155227.1.59396 WP_001155227.1.59407 WP_001155227.1.59409 WP_001155227.1.59413 WP_001155227.1.5942 WP_001155227.1.59423 WP_001155227.1.59425 WP_001155227.1.59426 WP_001155227.1.59434 WP_001155227.1.59470 WP_001155227.1.59483 WP_001155227.1.59491 WP_001155227.1.59513 WP_001155227.1.59533 WP_001155227.1.59553 WP_001155227.1.59572 WP_001155227.1.59577 WP_001155227.1.59579 WP_001155227.1.59590 WP_001155227.1.59611 WP_001155227.1.59613 WP_001155227.1.59615 WP_001155227.1.59621 WP_001155227.1.5963 WP_001155227.1.59638 WP_001155227.1.5965 WP_001155227.1.59660 WP_001155227.1.59679 WP_001155227.1.59680 WP_001155227.1.59689 WP_001155227.1.59699 WP_001155227.1.597 WP_001155227.1.59714 WP_001155227.1.59717 WP_001155227.1.59730 WP_001155227.1.59733 WP_001155227.1.59737 WP_001155227.1.59745 WP_001155227.1.59748 WP_001155227.1.59756 WP_001155227.1.59781 WP_001155227.1.59782 WP_001155227.1.59788 WP_001155227.1.59791 WP_001155227.1.59793 WP_001155227.1.59815 WP_001155227.1.59823 WP_001155227.1.59836 WP_001155227.1.59838 WP_001155227.1.59853 WP_001155227.1.59855 WP_001155227.1.59858 WP_001155227.1.59877 WP_001155227.1.59894 WP_001155227.1.5990 WP_001155227.1.59900 WP_001155227.1.59905 WP_001155227.1.59912 WP_001155227.1.59914 WP_001155227.1.59931 WP_001155227.1.59932 WP_001155227.1.59959 WP_001155227.1.59970 WP_001155227.1.59980 WP_001155227.1.59981 WP_001155227.1.59989 WP_001155227.1.59998 WP_001155227.1.60005 WP_001155227.1.6002 WP_001155227.1.60023 WP_001155227.1.60031 WP_001155227.1.60042 WP_001155227.1.60043 WP_001155227.1.60048 WP_001155227.1.60067 WP_001155227.1.60070 WP_001155227.1.60095 WP_001155227.1.60096 WP_001155227.1.60110 WP_001155227.1.60117 WP_001155227.1.6013 WP_001155227.1.60133 WP_001155227.1.60151 WP_001155227.1.60186 WP_001155227.1.6022 WP_001155227.1.60225 WP_001155227.1.60228 WP_001155227.1.60235 WP_001155227.1.60246 WP_001155227.1.60304 WP_001155227.1.60325 WP_001155227.1.60337 WP_001155227.1.60338 WP_001155227.1.60342 WP_001155227.1.60343 WP_001155227.1.60350 WP_001155227.1.60373 WP_001155227.1.60374 WP_001155227.1.60387 WP_001155227.1.60411 WP_001155227.1.60436 WP_001155227.1.60443 WP_001155227.1.60453 WP_001155227.1.60457 WP_001155227.1.60461 WP_001155227.1.60477 WP_001155227.1.60491 WP_001155227.1.60498 WP_001155227.1.60505 WP_001155227.1.60544 WP_001155227.1.60550 WP_001155227.1.60555 WP_001155227.1.60559 WP_001155227.1.60567 WP_001155227.1.60570 WP_001155227.1.60576 WP_001155227.1.60586 WP_001155227.1.6059 WP_001155227.1.60591 WP_001155227.1.60599 WP_001155227.1.60606 WP_001155227.1.6061 WP_001155227.1.60613 WP_001155227.1.60614 WP_001155227.1.60630 WP_001155227.1.6064 WP_001155227.1.60644 WP_001155227.1.60647 WP_001155227.1.60654 WP_001155227.1.6066 WP_001155227.1.60671 WP_001155227.1.6068 WP_001155227.1.60684 WP_001155227.1.60698 WP_001155227.1.60717 WP_001155227.1.60732 WP_001155227.1.60744 WP_001155227.1.60761 WP_001155227.1.60764 WP_001155227.1.60771 WP_001155227.1.60784 WP_001155227.1.60805 WP_001155227.1.60816 WP_001155227.1.60826 WP_001155227.1.60832 WP_001155227.1.60835 WP_001155227.1.60847 WP_001155227.1.60872 WP_001155227.1.60895 WP_001155227.1.60901 WP_001155227.1.60921 WP_001155227.1.60925 WP_001155227.1.60927 WP_001155227.1.60935 WP_001155227.1.6094 WP_001155227.1.6095 WP_001155227.1.60974 WP_001155227.1.61005 WP_001155227.1.61006 WP_001155227.1.61008 WP_001155227.1.61035 WP_001155227.1.61039 WP_001155227.1.61046 WP_001155227.1.61058 WP_001155227.1.6106 WP_001155227.1.61096 WP_001155227.1.61097 WP_001155227.1.61099 WP_001155227.1.6110 WP_001155227.1.61102 WP_001155227.1.61108 WP_001155227.1.61112 WP_001155227.1.61121 WP_001155227.1.61132 WP_001155227.1.61148 WP_001155227.1.61170 WP_001155227.1.61174 WP_001155227.1.61175 WP_001155227.1.61181 WP_001155227.1.61183 WP_001155227.1.61186 WP_001155227.1.61223 WP_001155227.1.61225 WP_001155227.1.61241 WP_001155227.1.61245 WP_001155227.1.61253 WP_001155227.1.61268 WP_001155227.1.61284 WP_001155227.1.61292 WP_001155227.1.613 WP_001155227.1.61360 WP_001155227.1.61362 WP_001155227.1.61364 WP_001155227.1.61373 WP_001155227.1.6138 WP_001155227.1.61398 WP_001155227.1.61442 WP_001155227.1.61445 WP_001155227.1.61496 WP_001155227.1.615 WP_001155227.1.61505 WP_001155227.1.61517 WP_001155227.1.61524 WP_001155227.1.61551 WP_001155227.1.61601 WP_001155227.1.61608 WP_001155227.1.61612 WP_001155227.1.61617 WP_001155227.1.61623 WP_001155227.1.61636 WP_001155227.1.61643 WP_001155227.1.61663 WP_001155227.1.61703 WP_001155227.1.61718 WP_001155227.1.61739 WP_001155227.1.61758 WP_001155227.1.61770 WP_001155227.1.61772 WP_001155227.1.61779 WP_001155227.1.61789 WP_001155227.1.618 WP_001155227.1.61806 WP_001155227.1.61822 WP_001155227.1.61835 WP_001155227.1.6185 WP_001155227.1.61853 WP_001155227.1.61858 WP_001155227.1.61874 WP_001155227.1.61893 WP_001155227.1.61926 WP_001155227.1.61939 WP_001155227.1.61948 WP_001155227.1.61949 WP_001155227.1.61955 WP_001155227.1.61957 WP_001155227.1.61966 WP_001155227.1.61985 WP_001155227.1.62015 WP_001155227.1.62038 WP_001155227.1.62041 WP_001155227.1.62043 WP_001155227.1.62091 WP_001155227.1.62099 WP_001155227.1.62102 WP_001155227.1.6212 WP_001155227.1.62135 WP_001155227.1.62157 WP_001155227.1.62182 WP_001155227.1.62207 WP_001155227.1.62236 WP_001155227.1.62262 WP_001155227.1.62264 WP_001155227.1.62266 WP_001155227.1.62273 WP_001155227.1.62282 WP_001155227.1.62290 WP_001155227.1.62296 WP_001155227.1.62303 WP_001155227.1.62322 WP_001155227.1.62337 WP_001155227.1.62348 WP_001155227.1.62358 WP_001155227.1.62424 WP_001155227.1.62447 WP_001155227.1.6245 WP_001155227.1.62454 WP_001155227.1.62460 WP_001155227.1.62480 WP_001155227.1.62481 WP_001155227.1.62487 WP_001155227.1.62503 WP_001155227.1.62507 WP_001155227.1.62513 WP_001155227.1.62514 WP_001155227.1.62529 WP_001155227.1.62541 WP_001155227.1.62555 WP_001155227.1.62586 WP_001155227.1.62605 WP_001155227.1.6261 WP_001155227.1.62612 WP_001155227.1.62631 WP_001155227.1.62642 WP_001155227.1.62646 WP_001155227.1.62668 WP_001155227.1.62675 WP_001155227.1.62681 WP_001155227.1.62682 WP_001155227.1.62714 WP_001155227.1.62735 WP_001155227.1.62750 WP_001155227.1.62753 WP_001155227.1.62762 WP_001155227.1.62769 WP_001155227.1.62780 WP_001155227.1.62784 WP_001155227.1.62787 WP_001155227.1.62788 WP_001155227.1.62802 WP_001155227.1.62812 WP_001155227.1.62818 WP_001155227.1.62819 WP_001155227.1.6282 WP_001155227.1.62840 WP_001155227.1.62843 WP_001155227.1.62850 WP_001155227.1.62851 WP_001155227.1.62866 WP_001155227.1.6287 WP_001155227.1.62885 WP_001155227.1.62888 WP_001155227.1.62914 WP_001155227.1.62919 WP_001155227.1.6293 WP_001155227.1.62931 WP_001155227.1.62951 WP_001155227.1.62959 WP_001155227.1.62973 WP_001155227.1.62989 WP_001155227.1.6299 WP_001155227.1.62992 WP_001155227.1.63023 WP_001155227.1.6307 WP_001155227.1.63078 WP_001155227.1.63113 WP_001155227.1.63167 WP_001155227.1.63177 WP_001155227.1.63189 WP_001155227.1.63198 WP_001155227.1.6323 WP_001155227.1.63246 WP_001155227.1.63271 WP_001155227.1.63285 WP_001155227.1.63287 WP_001155227.1.63305 WP_001155227.1.6331 WP_001155227.1.63310 WP_001155227.1.63330 WP_001155227.1.6334 WP_001155227.1.63350 WP_001155227.1.6337 WP_001155227.1.63370 WP_001155227.1.63374 WP_001155227.1.63385 WP_001155227.1.63393 WP_001155227.1.63419 WP_001155227.1.63433 WP_001155227.1.63437 WP_001155227.1.63444 WP_001155227.1.63445 WP_001155227.1.63453 WP_001155227.1.63465 WP_001155227.1.63466 WP_001155227.1.63467 WP_001155227.1.63470 WP_001155227.1.63478 WP_001155227.1.6348 WP_001155227.1.63484 WP_001155227.1.63487 WP_001155227.1.63491 WP_001155227.1.63496 WP_001155227.1.63536 WP_001155227.1.63554 WP_001155227.1.63556 WP_001155227.1.63563 WP_001155227.1.63576 WP_001155227.1.63586 WP_001155227.1.63602 WP_001155227.1.63608 WP_001155227.1.63612 WP_001155227.1.63615 WP_001155227.1.6364 WP_001155227.1.63666 WP_001155227.1.63679 WP_001155227.1.63683 WP_001155227.1.6369 WP_001155227.1.63703 WP_001155227.1.63721 WP_001155227.1.63746 WP_001155227.1.63800 WP_001155227.1.63810 WP_001155227.1.63814 WP_001155227.1.63821 WP_001155227.1.63856 WP_001155227.1.63871 WP_001155227.1.63872 WP_001155227.1.63944 WP_001155227.1.63957 WP_001155227.1.63964 WP_001155227.1.63969 WP_001155227.1.63990 WP_001155227.1.64008 WP_001155227.1.64014 WP_001155227.1.64030 WP_001155227.1.64040 WP_001155227.1.64045 WP_001155227.1.64050 WP_001155227.1.64053 WP_001155227.1.64074 WP_001155227.1.64080 WP_001155227.1.64086 WP_001155227.1.64110 WP_001155227.1.64138 WP_001155227.1.64150 WP_001155227.1.64153 WP_001155227.1.6416 WP_001155227.1.64161 WP_001155227.1.64165 WP_001155227.1.64175 WP_001155227.1.64180 WP_001155227.1.64190 WP_001155227.1.64193 WP_001155227.1.64280 WP_001155227.1.64285 WP_001155227.1.64286 WP_001155227.1.6429 WP_001155227.1.643 WP_001155227.1.6431 WP_001155227.1.64312 WP_001155227.1.64330 WP_001155227.1.64337 WP_001155227.1.64353 WP_001155227.1.64355 WP_001155227.1.64356 WP_001155227.1.64371 WP_001155227.1.64380 WP_001155227.1.64391 WP_001155227.1.6441 WP_001155227.1.64417 WP_001155227.1.64437 WP_001155227.1.64438 WP_001155227.1.6444 WP_001155227.1.64448 WP_001155227.1.6445 WP_001155227.1.64458 WP_001155227.1.6446 WP_001155227.1.64519 WP_001155227.1.64520 WP_001155227.1.64528 WP_001155227.1.64540 WP_001155227.1.64547 WP_001155227.1.64563 WP_001155227.1.64621 WP_001155227.1.64634 WP_001155227.1.64657 WP_001155227.1.64670 WP_001155227.1.6469 WP_001155227.1.64693 WP_001155227.1.64695 WP_001155227.1.647 WP_001155227.1.64707 WP_001155227.1.64712 WP_001155227.1.64746 WP_001155227.1.64749 WP_001155227.1.64784 WP_001155227.1.64789 WP_001155227.1.64793 WP_001155227.1.64821 WP_001155227.1.64840 WP_001155227.1.64866 WP_001155227.1.64875 WP_001155227.1.64881 WP_001155227.1.64895 WP_001155227.1.64901 WP_001155227.1.64912 WP_001155227.1.64926 WP_001155227.1.64930 WP_001155227.1.64939 WP_001155227.1.64946 WP_001155227.1.64970 WP_001155227.1.6499 WP_001155227.1.64990 WP_001155227.1.6500 WP_001155227.1.65023 WP_001155227.1.65035 WP_001155227.1.65040 WP_001155227.1.65056 WP_001155227.1.65061 WP_001155227.1.65084 WP_001155227.1.65085 WP_001155227.1.65097 WP_001155227.1.651 WP_001155227.1.65104 WP_001155227.1.6511 WP_001155227.1.65110 WP_001155227.1.65114 WP_001155227.1.65116 WP_001155227.1.65118 WP_001155227.1.65122 WP_001155227.1.65135 WP_001155227.1.65151 WP_001155227.1.65155 WP_001155227.1.65179 WP_001155227.1.65192 WP_001155227.1.65194 WP_001155227.1.65206 WP_001155227.1.65240 WP_001155227.1.65256 WP_001155227.1.6527 WP_001155227.1.65271 WP_001155227.1.65286 WP_001155227.1.65296 WP_001155227.1.65305 WP_001155227.1.65306 WP_001155227.1.65353 WP_001155227.1.65355 WP_001155227.1.65364 WP_001155227.1.65366 WP_001155227.1.6537 WP_001155227.1.65370 WP_001155227.1.65372 WP_001155227.1.654 WP_001155227.1.65405 WP_001155227.1.65408 WP_001155227.1.65413 WP_001155227.1.65415 WP_001155227.1.65456 WP_001155227.1.65484 WP_001155227.1.65493 WP_001155227.1.65518 WP_001155227.1.6553 WP_001155227.1.65531 WP_001155227.1.65546 WP_001155227.1.65565 WP_001155227.1.65571 WP_001155227.1.65581 WP_001155227.1.65596 WP_001155227.1.65606 WP_001155227.1.6563 WP_001155227.1.65662 WP_001155227.1.65667 WP_001155227.1.65672 WP_001155227.1.65677 WP_001155227.1.65708 WP_001155227.1.65714 WP_001155227.1.65749 WP_001155227.1.6576 WP_001155227.1.65762 WP_001155227.1.65768 WP_001155227.1.65834 WP_001155227.1.6587 WP_001155227.1.65875 WP_001155227.1.65898 WP_001155227.1.65912 WP_001155227.1.65954 WP_001155227.1.65957 WP_001155227.1.65961 WP_001155227.1.65962 WP_001155227.1.65963 WP_001155227.1.65976 WP_001155227.1.65978 WP_001155227.1.65988 WP_001155227.1.6599 WP_001155227.1.65991 WP_001155227.1.66001 WP_001155227.1.66007 WP_001155227.1.66016 WP_001155227.1.66017 WP_001155227.1.66022 WP_001155227.1.66033 WP_001155227.1.6604 WP_001155227.1.66044 WP_001155227.1.66050 WP_001155227.1.66059 WP_001155227.1.66071 WP_001155227.1.6609 WP_001155227.1.66094 WP_001155227.1.66100 WP_001155227.1.66102 WP_001155227.1.66104 WP_001155227.1.66105 WP_001155227.1.66121 WP_001155227.1.66127 WP_001155227.1.66161 WP_001155227.1.6618 WP_001155227.1.66181 WP_001155227.1.66187 WP_001155227.1.66197 WP_001155227.1.6622 WP_001155227.1.66251 WP_001155227.1.66255 WP_001155227.1.66264 WP_001155227.1.66280 WP_001155227.1.66288 WP_001155227.1.66290 WP_001155227.1.66295 WP_001155227.1.66327 WP_001155227.1.66335 WP_001155227.1.6635 WP_001155227.1.66376 WP_001155227.1.66387 WP_001155227.1.66389 WP_001155227.1.66392 WP_001155227.1.66395 WP_001155227.1.66412 WP_001155227.1.66421 WP_001155227.1.66432 WP_001155227.1.66448 WP_001155227.1.6645 WP_001155227.1.66501 WP_001155227.1.66511 WP_001155227.1.66523 WP_001155227.1.66531 WP_001155227.1.6654 WP_001155227.1.66550 WP_001155227.1.66559 WP_001155227.1.66566 WP_001155227.1.66579 WP_001155227.1.66624 WP_001155227.1.66644 WP_001155227.1.6665 WP_001155227.1.6666 WP_001155227.1.66667 WP_001155227.1.66668 WP_001155227.1.66700 WP_001155227.1.66706 WP_001155227.1.66708 WP_001155227.1.66719 WP_001155227.1.66727 WP_001155227.1.66751 WP_001155227.1.66758 WP_001155227.1.6676 WP_001155227.1.66783 WP_001155227.1.66787 WP_001155227.1.66791 WP_001155227.1.66794 WP_001155227.1.66795 WP_001155227.1.66796 WP_001155227.1.66849 WP_001155227.1.66873 WP_001155227.1.66922 WP_001155227.1.66926 WP_001155227.1.66933 WP_001155227.1.66948 WP_001155227.1.66975 WP_001155227.1.66978 WP_001155227.1.6698 WP_001155227.1.66984 WP_001155227.1.6701 WP_001155227.1.67018 WP_001155227.1.67021 WP_001155227.1.67022 WP_001155227.1.67026 WP_001155227.1.67029 WP_001155227.1.67035 WP_001155227.1.67047 WP_001155227.1.67055 WP_001155227.1.6706 WP_001155227.1.67073 WP_001155227.1.67102 WP_001155227.1.67106 WP_001155227.1.67116 WP_001155227.1.67120 WP_001155227.1.67132 WP_001155227.1.67136 WP_001155227.1.67137 WP_001155227.1.67149 WP_001155227.1.67150 WP_001155227.1.67153 WP_001155227.1.67158 WP_001155227.1.67164 WP_001155227.1.67166 WP_001155227.1.67174 WP_001155227.1.67193 WP_001155227.1.67194 WP_001155227.1.67200 WP_001155227.1.67209 WP_001155227.1.67210 WP_001155227.1.67214 WP_001155227.1.6723 WP_001155227.1.67258 WP_001155227.1.67272 WP_001155227.1.67278 WP_001155227.1.67284 WP_001155227.1.67293 WP_001155227.1.6735 WP_001155227.1.67373 WP_001155227.1.67383 WP_001155227.1.67391 WP_001155227.1.67412 WP_001155227.1.67415 WP_001155227.1.67427 WP_001155227.1.67446 WP_001155227.1.67451 WP_001155227.1.67452 WP_001155227.1.67454 WP_001155227.1.67456 WP_001155227.1.67462 WP_001155227.1.67464 WP_001155227.1.67467 WP_001155227.1.67468 WP_001155227.1.67495 WP_001155227.1.67522 WP_001155227.1.67533 WP_001155227.1.67538 WP_001155227.1.67549 WP_001155227.1.67553 WP_001155227.1.67581 WP_001155227.1.67590 WP_001155227.1.67606 WP_001155227.1.67660 WP_001155227.1.67663 WP_001155227.1.67669 WP_001155227.1.67676 WP_001155227.1.67681 WP_001155227.1.67685 WP_001155227.1.6769 WP_001155227.1.67690 WP_001155227.1.67701 WP_001155227.1.67704 WP_001155227.1.67724 WP_001155227.1.67726 WP_001155227.1.67732 WP_001155227.1.67737 WP_001155227.1.67753 WP_001155227.1.67758 WP_001155227.1.67760 WP_001155227.1.67775 WP_001155227.1.67780 WP_001155227.1.67786 WP_001155227.1.67787 WP_001155227.1.67788 WP_001155227.1.678 WP_001155227.1.67802 WP_001155227.1.67810 WP_001155227.1.67841 WP_001155227.1.67853 WP_001155227.1.67861 WP_001155227.1.67891 WP_001155227.1.67894 WP_001155227.1.67901 WP_001155227.1.6793 WP_001155227.1.67938 WP_001155227.1.67971 WP_001155227.1.67975 WP_001155227.1.67984 WP_001155227.1.67990 WP_001155227.1.67992 WP_001155227.1.67999 WP_001155227.1.68011 WP_001155227.1.68012 WP_001155227.1.6802 WP_001155227.1.68025 WP_001155227.1.6803 WP_001155227.1.68039 WP_001155227.1.68052 WP_001155227.1.68053 WP_001155227.1.68058 WP_001155227.1.68059 WP_001155227.1.68063 WP_001155227.1.68067 WP_001155227.1.68069 WP_001155227.1.68070 WP_001155227.1.68071 WP_001155227.1.68079 WP_001155227.1.68091 WP_001155227.1.68096 WP_001155227.1.6810 WP_001155227.1.68108 WP_001155227.1.68126 WP_001155227.1.68138 WP_001155227.1.6814 WP_001155227.1.68145 WP_001155227.1.68157 WP_001155227.1.68170 WP_001155227.1.68175 WP_001155227.1.68177 WP_001155227.1.682 WP_001155227.1.68200 WP_001155227.1.68215 WP_001155227.1.68231 WP_001155227.1.68241 WP_001155227.1.68255 WP_001155227.1.68271 WP_001155227.1.68278 WP_001155227.1.68279 WP_001155227.1.68281 WP_001155227.1.68283 WP_001155227.1.68292 WP_001155227.1.68336 WP_001155227.1.68341 WP_001155227.1.68347 WP_001155227.1.68362 WP_001155227.1.68369 WP_001155227.1.68372 WP_001155227.1.68395 WP_001155227.1.68396 WP_001155227.1.68410 WP_001155227.1.68411 WP_001155227.1.68441 WP_001155227.1.68442 WP_001155227.1.68482 WP_001155227.1.68493 WP_001155227.1.68523 WP_001155227.1.68524 WP_001155227.1.68534 WP_001155227.1.68566 WP_001155227.1.68572 WP_001155227.1.68584 WP_001155227.1.6859 WP_001155227.1.68598 WP_001155227.1.6860 WP_001155227.1.68609 WP_001155227.1.68630 WP_001155227.1.68632 WP_001155227.1.68635 WP_001155227.1.68673 WP_001155227.1.68678 WP_001155227.1.68695 WP_001155227.1.68697 WP_001155227.1.68701 WP_001155227.1.68711 WP_001155227.1.68731 WP_001155227.1.68735 WP_001155227.1.68750 WP_001155227.1.68751 WP_001155227.1.68752 WP_001155227.1.6877 WP_001155227.1.68793 WP_001155227.1.68795 WP_001155227.1.68797 WP_001155227.1.6880 WP_001155227.1.68801 WP_001155227.1.68838 WP_001155227.1.68847 WP_001155227.1.68865 WP_001155227.1.6887 WP_001155227.1.68873 WP_001155227.1.68877 WP_001155227.1.68880 WP_001155227.1.68911 WP_001155227.1.68915 WP_001155227.1.6892 WP_001155227.1.68924 WP_001155227.1.68936 WP_001155227.1.68942 WP_001155227.1.68952 WP_001155227.1.68956 WP_001155227.1.68961 WP_001155227.1.6897 WP_001155227.1.68989 WP_001155227.1.68995 WP_001155227.1.69033 WP_001155227.1.69039 WP_001155227.1.69054 WP_001155227.1.69098 WP_001155227.1.69126 WP_001155227.1.69127 WP_001155227.1.69144 WP_001155227.1.69145 WP_001155227.1.69158 WP_001155227.1.6916 WP_001155227.1.69160 WP_001155227.1.6919 WP_001155227.1.69192 WP_001155227.1.6921 WP_001155227.1.69221 WP_001155227.1.6923 WP_001155227.1.69247 WP_001155227.1.69258 WP_001155227.1.69261 WP_001155227.1.6929 WP_001155227.1.69303 WP_001155227.1.69305 WP_001155227.1.69327 WP_001155227.1.69341 WP_001155227.1.69350 WP_001155227.1.69351 WP_001155227.1.69382 WP_001155227.1.69390 WP_001155227.1.694 WP_001155227.1.69404 WP_001155227.1.69438 WP_001155227.1.69441 WP_001155227.1.6945 WP_001155227.1.69450 WP_001155227.1.69472 WP_001155227.1.69473 WP_001155227.1.69502 WP_001155227.1.69506 WP_001155227.1.69537 WP_001155227.1.69551 WP_001155227.1.69569 WP_001155227.1.69583 WP_001155227.1.69589 WP_001155227.1.69593 WP_001155227.1.69596 WP_001155227.1.69605 WP_001155227.1.69643 WP_001155227.1.69646 WP_001155227.1.69649 WP_001155227.1.69655 WP_001155227.1.69689 WP_001155227.1.697 WP_001155227.1.69716 WP_001155227.1.69730 WP_001155227.1.69735 WP_001155227.1.69775 WP_001155227.1.69780 WP_001155227.1.69786 WP_001155227.1.69803 WP_001155227.1.69810 WP_001155227.1.69818 WP_001155227.1.69831 WP_001155227.1.69832 WP_001155227.1.69840 WP_001155227.1.69868 WP_001155227.1.69872 WP_001155227.1.69887 WP_001155227.1.69896 WP_001155227.1.6993 WP_001155227.1.69963 WP_001155227.1.69972 WP_001155227.1.69979 WP_001155227.1.69999 WP_001155227.1.7001 WP_001155227.1.70041 WP_001155227.1.70063 WP_001155227.1.70081 WP_001155227.1.701 WP_001155227.1.70123 WP_001155227.1.70125 WP_001155227.1.7013 WP_001155227.1.70149 WP_001155227.1.7015 WP_001155227.1.70190 WP_001155227.1.70191 WP_001155227.1.70200 WP_001155227.1.70213 WP_001155227.1.70230 WP_001155227.1.70251 WP_001155227.1.70259 WP_001155227.1.70264 WP_001155227.1.70299 WP_001155227.1.70300 WP_001155227.1.70337 WP_001155227.1.70341 WP_001155227.1.70357 WP_001155227.1.70370 WP_001155227.1.70386 WP_001155227.1.70407 WP_001155227.1.70408 WP_001155227.1.70414 WP_001155227.1.70477 WP_001155227.1.70492 WP_001155227.1.7050 WP_001155227.1.70509 WP_001155227.1.70517 WP_001155227.1.7052 WP_001155227.1.70530 WP_001155227.1.70539 WP_001155227.1.70563 WP_001155227.1.70576 WP_001155227.1.70578 WP_001155227.1.70582 WP_001155227.1.70592 WP_001155227.1.70597 WP_001155227.1.70600 WP_001155227.1.70619 WP_001155227.1.70628 WP_001155227.1.70655 WP_001155227.1.70686 WP_001155227.1.70694 WP_001155227.1.70698 WP_001155227.1.70705 WP_001155227.1.70713 WP_001155227.1.70723 WP_001155227.1.70728 WP_001155227.1.70745 WP_001155227.1.70747 WP_001155227.1.70748 WP_001155227.1.70767 WP_001155227.1.70784 WP_001155227.1.70787 WP_001155227.1.70794 WP_001155227.1.70801 WP_001155227.1.70803 WP_001155227.1.70880 WP_001155227.1.70896 WP_001155227.1.7090 WP_001155227.1.70900 WP_001155227.1.70952 WP_001155227.1.70967 WP_001155227.1.71003 WP_001155227.1.7102 WP_001155227.1.71037 WP_001155227.1.71042 WP_001155227.1.71062 WP_001155227.1.71099 WP_001155227.1.71109 WP_001155227.1.71113 WP_001155227.1.71134 WP_001155227.1.71139 WP_001155227.1.71144 WP_001155227.1.71147 WP_001155227.1.71149 WP_001155227.1.71158 WP_001155227.1.71159 WP_001155227.1.71162 WP_001155227.1.71170 WP_001155227.1.71176 WP_001155227.1.71183 WP_001155227.1.71192 WP_001155227.1.71199 WP_001155227.1.71205 WP_001155227.1.7121 WP_001155227.1.71221 WP_001155227.1.71223 WP_001155227.1.71225 WP_001155227.1.71226 WP_001155227.1.71229 WP_001155227.1.71264 WP_001155227.1.71269 WP_001155227.1.71272 WP_001155227.1.71275 WP_001155227.1.71285 WP_001155227.1.71287 WP_001155227.1.71294 WP_001155227.1.71311 WP_001155227.1.71312 WP_001155227.1.71315 WP_001155227.1.71323 WP_001155227.1.71327 WP_001155227.1.71339 WP_001155227.1.71354 WP_001155227.1.71397 WP_001155227.1.71403 WP_001155227.1.71405 WP_001155227.1.71409 WP_001155227.1.71421 WP_001155227.1.71423 WP_001155227.1.71448 WP_001155227.1.7147 WP_001155227.1.71480 WP_001155227.1.71522 WP_001155227.1.71528 WP_001155227.1.71533 WP_001155227.1.71537 WP_001155227.1.71538 WP_001155227.1.71540 WP_001155227.1.71560 WP_001155227.1.71562 WP_001155227.1.71563 WP_001155227.1.71603 WP_001155227.1.71607 WP_001155227.1.71632 WP_001155227.1.71680 WP_001155227.1.71690 WP_001155227.1.71695 WP_001155227.1.71712 WP_001155227.1.71724 WP_001155227.1.71732 WP_001155227.1.71757 WP_001155227.1.71767 WP_001155227.1.71783 WP_001155227.1.71830 WP_001155227.1.71837 WP_001155227.1.71840 WP_001155227.1.71855 WP_001155227.1.71856 WP_001155227.1.71874 WP_001155227.1.71912 WP_001155227.1.7192 WP_001155227.1.71922 WP_001155227.1.71938 WP_001155227.1.71939 WP_001155227.1.71940 WP_001155227.1.71944 WP_001155227.1.71945 WP_001155227.1.71967 WP_001155227.1.71972 WP_001155227.1.71975 WP_001155227.1.71987 WP_001155227.1.71993 WP_001155227.1.71995 WP_001155227.1.72013 WP_001155227.1.72016 WP_001155227.1.72021 WP_001155227.1.72028 WP_001155227.1.72033 WP_001155227.1.72048 WP_001155227.1.7205 WP_001155227.1.72053 WP_001155227.1.72054 WP_001155227.1.72066 WP_001155227.1.72090 WP_001155227.1.72098 WP_001155227.1.7210 WP_001155227.1.72117 WP_001155227.1.72120 WP_001155227.1.72125 WP_001155227.1.72126 WP_001155227.1.72141 WP_001155227.1.72153 WP_001155227.1.72155 WP_001155227.1.72157 WP_001155227.1.72161 WP_001155227.1.72162 WP_001155227.1.72180 WP_001155227.1.72184 WP_001155227.1.72186 WP_001155227.1.72208 WP_001155227.1.72212 WP_001155227.1.72237 WP_001155227.1.72240 WP_001155227.1.72248 WP_001155227.1.7225 WP_001155227.1.72258 WP_001155227.1.72261 WP_001155227.1.72262 WP_001155227.1.72270 WP_001155227.1.72279 WP_001155227.1.72290 WP_001155227.1.72293 WP_001155227.1.72298 WP_001155227.1.723 WP_001155227.1.72316 WP_001155227.1.72322 WP_001155227.1.72337 WP_001155227.1.72342 WP_001155227.1.72352 WP_001155227.1.72359 WP_001155227.1.72362 WP_001155227.1.72388 WP_001155227.1.72391 WP_001155227.1.72392 WP_001155227.1.72397 WP_001155227.1.72414 WP_001155227.1.72425 WP_001155227.1.72427 WP_001155227.1.72431 WP_001155227.1.72434 WP_001155227.1.72436 WP_001155227.1.72449 WP_001155227.1.72469 WP_001155227.1.72485 WP_001155227.1.72493 WP_001155227.1.72500 WP_001155227.1.72507 WP_001155227.1.72511 WP_001155227.1.72521 WP_001155227.1.72522 WP_001155227.1.72535 WP_001155227.1.72537 WP_001155227.1.72544 WP_001155227.1.72551 WP_001155227.1.72574 WP_001155227.1.72582 WP_001155227.1.72588 WP_001155227.1.72593 WP_001155227.1.72596 WP_001155227.1.72599 WP_001155227.1.72606 WP_001155227.1.72608 WP_001155227.1.72614 WP_001155227.1.72615 WP_001155227.1.72616 WP_001155227.1.72619 WP_001155227.1.72641 WP_001155227.1.72643 WP_001155227.1.72651 WP_001155227.1.72663 WP_001155227.1.72694 WP_001155227.1.72695 WP_001155227.1.72698 WP_001155227.1.72700 WP_001155227.1.72706 WP_001155227.1.72725 WP_001155227.1.72738 WP_001155227.1.72745 WP_001155227.1.72747 WP_001155227.1.72748 WP_001155227.1.72751 WP_001155227.1.72758 WP_001155227.1.72764 WP_001155227.1.7277 WP_001155227.1.72778 WP_001155227.1.72804 WP_001155227.1.72806 WP_001155227.1.7281 WP_001155227.1.72837 WP_001155227.1.72857 WP_001155227.1.72858 WP_001155227.1.72860 WP_001155227.1.72869 WP_001155227.1.72893 WP_001155227.1.7291 WP_001155227.1.72910 WP_001155227.1.72913 WP_001155227.1.72947 WP_001155227.1.72950 WP_001155227.1.72956 WP_001155227.1.72962 WP_001155227.1.72972 WP_001155227.1.72998 WP_001155227.1.73000 WP_001155227.1.73010 WP_001155227.1.73015 WP_001155227.1.73032 WP_001155227.1.73039 WP_001155227.1.73061 WP_001155227.1.7307 WP_001155227.1.73072 WP_001155227.1.73075 WP_001155227.1.73085 WP_001155227.1.7309 WP_001155227.1.73094 WP_001155227.1.73126 WP_001155227.1.73129 WP_001155227.1.73174 WP_001155227.1.73197 WP_001155227.1.73215 WP_001155227.1.73217 WP_001155227.1.73230 WP_001155227.1.73239 WP_001155227.1.73243 WP_001155227.1.73249 WP_001155227.1.73251 WP_001155227.1.73257 WP_001155227.1.73259 WP_001155227.1.73277 WP_001155227.1.73278 WP_001155227.1.73283 WP_001155227.1.73291 WP_001155227.1.73292 WP_001155227.1.73295 WP_001155227.1.73326 WP_001155227.1.73333 WP_001155227.1.73340 WP_001155227.1.73343 WP_001155227.1.73344 WP_001155227.1.73349 WP_001155227.1.73385 WP_001155227.1.73428 WP_001155227.1.73430 WP_001155227.1.7345 WP_001155227.1.73468 WP_001155227.1.73486 WP_001155227.1.7349 WP_001155227.1.73498 WP_001155227.1.73524 WP_001155227.1.73565 WP_001155227.1.73572 WP_001155227.1.73592 WP_001155227.1.73604 WP_001155227.1.73626 WP_001155227.1.73631 WP_001155227.1.73652 WP_001155227.1.73663 WP_001155227.1.73700 WP_001155227.1.73709 WP_001155227.1.73717 WP_001155227.1.73743 WP_001155227.1.73748 WP_001155227.1.7376 WP_001155227.1.73783 WP_001155227.1.73785 WP_001155227.1.73797 WP_001155227.1.73801 WP_001155227.1.73807 WP_001155227.1.73811 WP_001155227.1.73827 WP_001155227.1.73835 WP_001155227.1.73843 WP_001155227.1.73844 WP_001155227.1.73846 WP_001155227.1.73859 WP_001155227.1.73882 WP_001155227.1.73897 WP_001155227.1.73908 WP_001155227.1.7392 WP_001155227.1.73934 WP_001155227.1.73942 WP_001155227.1.73968 WP_001155227.1.73980 WP_001155227.1.73992 WP_001155227.1.73995 WP_001155227.1.73996 WP_001155227.1.74032 WP_001155227.1.74041 WP_001155227.1.74045 WP_001155227.1.74046 WP_001155227.1.74051 WP_001155227.1.74053 WP_001155227.1.7407 WP_001155227.1.74123 WP_001155227.1.7413 WP_001155227.1.74156 WP_001155227.1.74184 WP_001155227.1.74185 WP_001155227.1.74213 WP_001155227.1.74223 WP_001155227.1.7424 WP_001155227.1.74243 WP_001155227.1.7425 WP_001155227.1.74251 WP_001155227.1.74267 WP_001155227.1.7429 WP_001155227.1.74294 WP_001155227.1.74309 WP_001155227.1.74358 WP_001155227.1.74365 WP_001155227.1.74367 WP_001155227.1.744 WP_001155227.1.74423 WP_001155227.1.74426 WP_001155227.1.74431 WP_001155227.1.74444 WP_001155227.1.74445 WP_001155227.1.7446 WP_001155227.1.74465 WP_001155227.1.74478 WP_001155227.1.74491 WP_001155227.1.74501 WP_001155227.1.74509 WP_001155227.1.74513 WP_001155227.1.74520 WP_001155227.1.74521 WP_001155227.1.74528 WP_001155227.1.74532 WP_001155227.1.74536 WP_001155227.1.74549 WP_001155227.1.74557 WP_001155227.1.74574 WP_001155227.1.7461 WP_001155227.1.74611 WP_001155227.1.74623 WP_001155227.1.74624 WP_001155227.1.74625 WP_001155227.1.74631 WP_001155227.1.74652 WP_001155227.1.74670 WP_001155227.1.74682 WP_001155227.1.74687 WP_001155227.1.74688 WP_001155227.1.74689 WP_001155227.1.74691 WP_001155227.1.74705 WP_001155227.1.7471 WP_001155227.1.74713 WP_001155227.1.74716 WP_001155227.1.74720 WP_001155227.1.74735 WP_001155227.1.7475 WP_001155227.1.74752 WP_001155227.1.74765 WP_001155227.1.74767 WP_001155227.1.7478 WP_001155227.1.7479 WP_001155227.1.74793 WP_001155227.1.74811 WP_001155227.1.74828 WP_001155227.1.74844 WP_001155227.1.74852 WP_001155227.1.74854 WP_001155227.1.74860 WP_001155227.1.74867 WP_001155227.1.74873 WP_001155227.1.74879 WP_001155227.1.74880 WP_001155227.1.74885 WP_001155227.1.74889 WP_001155227.1.74895 WP_001155227.1.74904 WP_001155227.1.74914 WP_001155227.1.74915 WP_001155227.1.74962 WP_001155227.1.74975 WP_001155227.1.74993 WP_001155227.1.74998 WP_001155227.1.75021 WP_001155227.1.75029 WP_001155227.1.75030 WP_001155227.1.75050 WP_001155227.1.75087 WP_001155227.1.75100 WP_001155227.1.75112 WP_001155227.1.75118 WP_001155227.1.75124 WP_001155227.1.75136 WP_001155227.1.75138 WP_001155227.1.75139 WP_001155227.1.75143 WP_001155227.1.75145 WP_001155227.1.75149 WP_001155227.1.75155 WP_001155227.1.7516 WP_001155227.1.75164 WP_001155227.1.75181 WP_001155227.1.75209 WP_001155227.1.75218 WP_001155227.1.75221 WP_001155227.1.75228 WP_001155227.1.75231 WP_001155227.1.75243 WP_001155227.1.75247 WP_001155227.1.75254 WP_001155227.1.75270 WP_001155227.1.75272 WP_001155227.1.75306 WP_001155227.1.7536 WP_001155227.1.75360 WP_001155227.1.75367 WP_001155227.1.75382 WP_001155227.1.7539 WP_001155227.1.75419 WP_001155227.1.75428 WP_001155227.1.75435 WP_001155227.1.75465 WP_001155227.1.75491 WP_001155227.1.75505 WP_001155227.1.75507 WP_001155227.1.75515 WP_001155227.1.75529 WP_001155227.1.75536 WP_001155227.1.75537 WP_001155227.1.75557 WP_001155227.1.75568 WP_001155227.1.75577 WP_001155227.1.75588 WP_001155227.1.75594 WP_001155227.1.75602 WP_001155227.1.75612 WP_001155227.1.75629 WP_001155227.1.75644 WP_001155227.1.75653 WP_001155227.1.75672 WP_001155227.1.75676 WP_001155227.1.75679 WP_001155227.1.75687 WP_001155227.1.75694 WP_001155227.1.75696 WP_001155227.1.75698 WP_001155227.1.75699 WP_001155227.1.75725 WP_001155227.1.75735 WP_001155227.1.75758 WP_001155227.1.75767 WP_001155227.1.75786 WP_001155227.1.75803 WP_001155227.1.75808 WP_001155227.1.7583 WP_001155227.1.75839 WP_001155227.1.75853 WP_001155227.1.75892 WP_001155227.1.75918 WP_001155227.1.75922 WP_001155227.1.7597 WP_001155227.1.75973 WP_001155227.1.75983 WP_001155227.1.75988 WP_001155227.1.75989 WP_001155227.1.75995 WP_001155227.1.75999 WP_001155227.1.76005 WP_001155227.1.76009 WP_001155227.1.76019 WP_001155227.1.7603 WP_001155227.1.76030 WP_001155227.1.76036 WP_001155227.1.76039 WP_001155227.1.76054 WP_001155227.1.76057 WP_001155227.1.7608 WP_001155227.1.76087 WP_001155227.1.76089 WP_001155227.1.76103 WP_001155227.1.76118 WP_001155227.1.76119 WP_001155227.1.76129 WP_001155227.1.7613 WP_001155227.1.76152 WP_001155227.1.7617 WP_001155227.1.76184 WP_001155227.1.76189 WP_001155227.1.76194 WP_001155227.1.76196 WP_001155227.1.76211 WP_001155227.1.76237 WP_001155227.1.76268 WP_001155227.1.76269 WP_001155227.1.76305 WP_001155227.1.76312 WP_001155227.1.76325 WP_001155227.1.76335 WP_001155227.1.76361 WP_001155227.1.7637 WP_001155227.1.76376 WP_001155227.1.76384 WP_001155227.1.76387 WP_001155227.1.76390 WP_001155227.1.76407 WP_001155227.1.76446 WP_001155227.1.76447 WP_001155227.1.76448 WP_001155227.1.76452 WP_001155227.1.76460 WP_001155227.1.76462 WP_001155227.1.76466 WP_001155227.1.76469 WP_001155227.1.76477 WP_001155227.1.76504 WP_001155227.1.76542 WP_001155227.1.76544 WP_001155227.1.76547 WP_001155227.1.76562 WP_001155227.1.76595 WP_001155227.1.76596 WP_001155227.1.7661 WP_001155227.1.76619 WP_001155227.1.76643 WP_001155227.1.76656 WP_001155227.1.76660 WP_001155227.1.76697 WP_001155227.1.76701 WP_001155227.1.76705 WP_001155227.1.76707 WP_001155227.1.76712 WP_001155227.1.76751 WP_001155227.1.76759 WP_001155227.1.7680 WP_001155227.1.76815 WP_001155227.1.76827 WP_001155227.1.76831 WP_001155227.1.76840 WP_001155227.1.76863 WP_001155227.1.76884 WP_001155227.1.7689 WP_001155227.1.76909 WP_001155227.1.76918 WP_001155227.1.76933 WP_001155227.1.76948 WP_001155227.1.76957 WP_001155227.1.76961 WP_001155227.1.76965 WP_001155227.1.76966 WP_001155227.1.7699 WP_001155227.1.76994 WP_001155227.1.77007 WP_001155227.1.77015 WP_001155227.1.77022 WP_001155227.1.77036 WP_001155227.1.77042 WP_001155227.1.77057 WP_001155227.1.77070 WP_001155227.1.77081 WP_001155227.1.77099 WP_001155227.1.771 WP_001155227.1.77109 WP_001155227.1.77120 WP_001155227.1.77128 WP_001155227.1.77134 WP_001155227.1.77147 WP_001155227.1.77162 WP_001155227.1.77163 WP_001155227.1.77173 WP_001155227.1.77175 WP_001155227.1.77198 WP_001155227.1.77200 WP_001155227.1.77204 WP_001155227.1.77214 WP_001155227.1.77224 WP_001155227.1.77239 WP_001155227.1.77253 WP_001155227.1.77255 WP_001155227.1.77258 WP_001155227.1.77275 WP_001155227.1.7728 WP_001155227.1.77284 WP_001155227.1.77288 WP_001155227.1.7729 WP_001155227.1.77290 WP_001155227.1.77291 WP_001155227.1.77296 WP_001155227.1.7731 WP_001155227.1.77326 WP_001155227.1.77341 WP_001155227.1.77358 WP_001155227.1.77391 WP_001155227.1.77392 WP_001155227.1.77408 WP_001155227.1.77419 WP_001155227.1.77432 WP_001155227.1.77437 WP_001155227.1.77448 WP_001155227.1.77452 WP_001155227.1.77455 WP_001155227.1.77462 WP_001155227.1.77470 WP_001155227.1.77471 WP_001155227.1.77477 WP_001155227.1.77481 WP_001155227.1.77487 WP_001155227.1.77495 WP_001155227.1.775 WP_001155227.1.7750 WP_001155227.1.77503 WP_001155227.1.77511 WP_001155227.1.77541 WP_001155227.1.77542 WP_001155227.1.77551 WP_001155227.1.7756 WP_001155227.1.77577 WP_001155227.1.77581 WP_001155227.1.77595 WP_001155227.1.77600 WP_001155227.1.77608 WP_001155227.1.77626 WP_001155227.1.77632 WP_001155227.1.77636 WP_001155227.1.77644 WP_001155227.1.77648 WP_001155227.1.77657 WP_001155227.1.77707 WP_001155227.1.77725 WP_001155227.1.77741 WP_001155227.1.7775 WP_001155227.1.77760 WP_001155227.1.77767 WP_001155227.1.77768 WP_001155227.1.7780 WP_001155227.1.7781 WP_001155227.1.77813 WP_001155227.1.77816 WP_001155227.1.77826 WP_001155227.1.77833 WP_001155227.1.77876 WP_001155227.1.77905 WP_001155227.1.77929 WP_001155227.1.77949 WP_001155227.1.77950 WP_001155227.1.77961 WP_001155227.1.77979 WP_001155227.1.7799 WP_001155227.1.77999 WP_001155227.1.78000 WP_001155227.1.78007 WP_001155227.1.78010 WP_001155227.1.7804 WP_001155227.1.78041 WP_001155227.1.78059 WP_001155227.1.7806 WP_001155227.1.78063 WP_001155227.1.7808 WP_001155227.1.78089 WP_001155227.1.78097 WP_001155227.1.78099 WP_001155227.1.78101 WP_001155227.1.78102 WP_001155227.1.78131 WP_001155227.1.78183 WP_001155227.1.78187 WP_001155227.1.78188 WP_001155227.1.78196 WP_001155227.1.78202 WP_001155227.1.78232 WP_001155227.1.78233 WP_001155227.1.78235 WP_001155227.1.78297 WP_001155227.1.78305 WP_001155227.1.78321 WP_001155227.1.78323 WP_001155227.1.78337 WP_001155227.1.78340 WP_001155227.1.78368 WP_001155227.1.78376 WP_001155227.1.78377 WP_001155227.1.78390 WP_001155227.1.784 WP_001155227.1.78413 WP_001155227.1.7843 WP_001155227.1.78445 WP_001155227.1.78453 WP_001155227.1.78462 WP_001155227.1.78463 WP_001155227.1.7847 WP_001155227.1.78477 WP_001155227.1.78481 WP_001155227.1.78491 WP_001155227.1.7851 WP_001155227.1.78512 WP_001155227.1.78515 WP_001155227.1.78523 WP_001155227.1.78527 WP_001155227.1.7855 WP_001155227.1.78553 WP_001155227.1.78572 WP_001155227.1.78575 WP_001155227.1.78581 WP_001155227.1.78583 WP_001155227.1.78586 WP_001155227.1.78593 WP_001155227.1.78610 WP_001155227.1.78611 WP_001155227.1.78612 WP_001155227.1.78615 WP_001155227.1.78622 WP_001155227.1.78645 WP_001155227.1.78677 WP_001155227.1.78683 WP_001155227.1.78687 WP_001155227.1.78689 WP_001155227.1.78696 WP_001155227.1.78698 WP_001155227.1.78706 WP_001155227.1.78714 WP_001155227.1.78718 WP_001155227.1.78746 WP_001155227.1.78750 WP_001155227.1.78757 WP_001155227.1.78773 WP_001155227.1.78775 WP_001155227.1.78791 WP_001155227.1.78814 WP_001155227.1.78843 WP_001155227.1.78845 WP_001155227.1.78854 WP_001155227.1.78888 WP_001155227.1.78891 WP_001155227.1.78893 WP_001155227.1.78895 WP_001155227.1.78906 WP_001155227.1.78908 WP_001155227.1.78919 WP_001155227.1.78953 WP_001155227.1.78955 WP_001155227.1.7896 WP_001155227.1.78966 WP_001155227.1.7898 WP_001155227.1.78996 WP_001155227.1.79001 WP_001155227.1.79002 WP_001155227.1.79004 WP_001155227.1.7901 WP_001155227.1.79065 WP_001155227.1.79067 WP_001155227.1.79075 WP_001155227.1.79086 WP_001155227.1.79088 WP_001155227.1.79090 WP_001155227.1.79092 WP_001155227.1.79100 WP_001155227.1.79126 WP_001155227.1.79137 WP_001155227.1.79159 WP_001155227.1.79172 WP_001155227.1.79226 WP_001155227.1.79233 WP_001155227.1.79243 WP_001155227.1.79246 WP_001155227.1.79248 WP_001155227.1.79249 WP_001155227.1.79276 WP_001155227.1.79306 WP_001155227.1.79308 WP_001155227.1.79312 WP_001155227.1.79342 WP_001155227.1.79343 WP_001155227.1.79346 WP_001155227.1.79348 WP_001155227.1.79356 WP_001155227.1.79365 WP_001155227.1.79368 WP_001155227.1.79369 WP_001155227.1.7937 WP_001155227.1.79389 WP_001155227.1.79391 WP_001155227.1.7940 WP_001155227.1.79409 WP_001155227.1.79414 WP_001155227.1.79416 WP_001155227.1.79443 WP_001155227.1.79464 WP_001155227.1.79478 WP_001155227.1.79505 WP_001155227.1.79519 WP_001155227.1.7952 WP_001155227.1.79525 WP_001155227.1.79526 WP_001155227.1.79528 WP_001155227.1.79540 WP_001155227.1.79558 WP_001155227.1.79563 WP_001155227.1.79576 WP_001155227.1.79591 WP_001155227.1.79606 WP_001155227.1.79619 WP_001155227.1.79640 WP_001155227.1.7967 WP_001155227.1.79685 WP_001155227.1.79707 WP_001155227.1.79713 WP_001155227.1.79715 WP_001155227.1.79749 WP_001155227.1.79759 WP_001155227.1.79764 WP_001155227.1.79800 WP_001155227.1.79816 WP_001155227.1.79824 WP_001155227.1.79840 WP_001155227.1.7985 WP_001155227.1.79866 WP_001155227.1.79869 WP_001155227.1.7987 WP_001155227.1.79871 WP_001155227.1.79877 WP_001155227.1.79905 WP_001155227.1.79922 WP_001155227.1.7993 WP_001155227.1.79930 WP_001155227.1.79931 WP_001155227.1.79932 WP_001155227.1.79933 WP_001155227.1.79936 WP_001155227.1.79944 WP_001155227.1.79952 WP_001155227.1.79955 WP_001155227.1.79965 WP_001155227.1.79973 WP_001155227.1.79984 WP_001155227.1.79995 WP_001155227.1.80 WP_001155227.1.80011 WP_001155227.1.80016 WP_001155227.1.80026 WP_001155227.1.8004 WP_001155227.1.80043 WP_001155227.1.80060 WP_001155227.1.80061 WP_001155227.1.80063 WP_001155227.1.8007 WP_001155227.1.80071 WP_001155227.1.80096 WP_001155227.1.80106 WP_001155227.1.8011 WP_001155227.1.80112 WP_001155227.1.80136 WP_001155227.1.80141 WP_001155227.1.80168 WP_001155227.1.80176 WP_001155227.1.80179 WP_001155227.1.80183 WP_001155227.1.80192 WP_001155227.1.80198 WP_001155227.1.80255 WP_001155227.1.80292 WP_001155227.1.80309 WP_001155227.1.80310 WP_001155227.1.80320 WP_001155227.1.80330 WP_001155227.1.80343 WP_001155227.1.80388 WP_001155227.1.80392 WP_001155227.1.804 WP_001155227.1.80402 WP_001155227.1.80426 WP_001155227.1.80428 WP_001155227.1.80440 WP_001155227.1.80444 WP_001155227.1.80456 WP_001155227.1.80463 WP_001155227.1.80484 WP_001155227.1.80517 WP_001155227.1.80519 WP_001155227.1.80524 WP_001155227.1.80545 WP_001155227.1.80558 WP_001155227.1.80559 WP_001155227.1.8057 WP_001155227.1.80577 WP_001155227.1.80578 WP_001155227.1.80594 WP_001155227.1.80606 WP_001155227.1.80612 WP_001155227.1.80626 WP_001155227.1.80660 WP_001155227.1.80662 WP_001155227.1.80666 WP_001155227.1.80676 WP_001155227.1.8068 WP_001155227.1.80709 WP_001155227.1.80718 WP_001155227.1.80724 WP_001155227.1.80731 WP_001155227.1.80736 WP_001155227.1.80737 WP_001155227.1.8074 WP_001155227.1.80753 WP_001155227.1.80754 WP_001155227.1.8076 WP_001155227.1.80768 WP_001155227.1.80789 WP_001155227.1.808 WP_001155227.1.80804 WP_001155227.1.80805 WP_001155227.1.80843 WP_001155227.1.80862 WP_001155227.1.80882 WP_001155227.1.80884 WP_001155227.1.80894 WP_001155227.1.8091 WP_001155227.1.80935 WP_001155227.1.80945 WP_001155227.1.80946 WP_001155227.1.80948 WP_001155227.1.80954 WP_001155227.1.80966 WP_001155227.1.80983 WP_001155227.1.80985 WP_001155227.1.810 WP_001155227.1.81026 WP_001155227.1.81032 WP_001155227.1.81034 WP_001155227.1.81036 WP_001155227.1.81054 WP_001155227.1.81056 WP_001155227.1.81070 WP_001155227.1.81071 WP_001155227.1.81098 WP_001155227.1.811 WP_001155227.1.81104 WP_001155227.1.81120 WP_001155227.1.81127 WP_001155227.1.81141 WP_001155227.1.81156 WP_001155227.1.81160 WP_001155227.1.81165 WP_001155227.1.8118 WP_001155227.1.81180 WP_001155227.1.81182 WP_001155227.1.81186 WP_001155227.1.8121 WP_001155227.1.81219 WP_001155227.1.81266 WP_001155227.1.81267 WP_001155227.1.81273 WP_001155227.1.81281 WP_001155227.1.81283 WP_001155227.1.81286 WP_001155227.1.8129 WP_001155227.1.81298 WP_001155227.1.81313 WP_001155227.1.81316 WP_001155227.1.81323 WP_001155227.1.81347 WP_001155227.1.81376 WP_001155227.1.81391 WP_001155227.1.81396 WP_001155227.1.814 WP_001155227.1.81418 WP_001155227.1.81420 WP_001155227.1.81423 WP_001155227.1.81438 WP_001155227.1.81442 WP_001155227.1.81469 WP_001155227.1.81475 WP_001155227.1.81484 WP_001155227.1.81514 WP_001155227.1.81517 WP_001155227.1.8152 WP_001155227.1.8156 WP_001155227.1.81576 WP_001155227.1.81577 WP_001155227.1.81580 WP_001155227.1.81582 WP_001155227.1.81588 WP_001155227.1.81589 WP_001155227.1.81596 WP_001155227.1.81602 WP_001155227.1.81618 WP_001155227.1.81624 WP_001155227.1.81625 WP_001155227.1.81688 WP_001155227.1.81692 WP_001155227.1.81715 WP_001155227.1.8172 WP_001155227.1.81723 WP_001155227.1.81739 WP_001155227.1.81754 WP_001155227.1.81761 WP_001155227.1.81806 WP_001155227.1.81819 WP_001155227.1.81821 WP_001155227.1.8183 WP_001155227.1.81832 WP_001155227.1.81843 WP_001155227.1.81869 WP_001155227.1.81873 WP_001155227.1.81876 WP_001155227.1.81881 WP_001155227.1.81888 WP_001155227.1.81914 WP_001155227.1.81934 WP_001155227.1.81935 WP_001155227.1.81939 WP_001155227.1.81952 WP_001155227.1.81956 WP_001155227.1.81972 WP_001155227.1.81975 WP_001155227.1.82 WP_001155227.1.82008 WP_001155227.1.82010 WP_001155227.1.82032 WP_001155227.1.82057 WP_001155227.1.82059 WP_001155227.1.82061 WP_001155227.1.82062 WP_001155227.1.82074 WP_001155227.1.82095 WP_001155227.1.82104 WP_001155227.1.82106 WP_001155227.1.82116 WP_001155227.1.82123 WP_001155227.1.82137 WP_001155227.1.82166 WP_001155227.1.82217 WP_001155227.1.82221 WP_001155227.1.82239 WP_001155227.1.82240 WP_001155227.1.82242 WP_001155227.1.82246 WP_001155227.1.82275 WP_001155227.1.82280 WP_001155227.1.82296 WP_001155227.1.82316 WP_001155227.1.82320 WP_001155227.1.82326 WP_001155227.1.82330 WP_001155227.1.8235 WP_001155227.1.82378 WP_001155227.1.82438 WP_001155227.1.82439 WP_001155227.1.82482 WP_001155227.1.82485 WP_001155227.1.8249 WP_001155227.1.82499 WP_001155227.1.82507 WP_001155227.1.82514 WP_001155227.1.82527 WP_001155227.1.82536 WP_001155227.1.82539 WP_001155227.1.8255 WP_001155227.1.82572 WP_001155227.1.82589 WP_001155227.1.82594 WP_001155227.1.82614 WP_001155227.1.82626 WP_001155227.1.82629 WP_001155227.1.82647 WP_001155227.1.82661 WP_001155227.1.8268 WP_001155227.1.82682 WP_001155227.1.82691 WP_001155227.1.82698 WP_001155227.1.82700 WP_001155227.1.82705 WP_001155227.1.82711 WP_001155227.1.82715 WP_001155227.1.82718 WP_001155227.1.82747 WP_001155227.1.82754 WP_001155227.1.8277 WP_001155227.1.82776 WP_001155227.1.82780 WP_001155227.1.82784 WP_001155227.1.82797 WP_001155227.1.82799 WP_001155227.1.82808 WP_001155227.1.82816 WP_001155227.1.82820 WP_001155227.1.82833 WP_001155227.1.82853 WP_001155227.1.82901 WP_001155227.1.82902 WP_001155227.1.82923 WP_001155227.1.8295 WP_001155227.1.82991 WP_001155227.1.83020 WP_001155227.1.83033 WP_001155227.1.83035 WP_001155227.1.83036 WP_001155227.1.83051 WP_001155227.1.83059 WP_001155227.1.8306 WP_001155227.1.8308 WP_001155227.1.83093 WP_001155227.1.83097 WP_001155227.1.83099 WP_001155227.1.831 WP_001155227.1.83118 WP_001155227.1.83125 WP_001155227.1.83127 WP_001155227.1.83140 WP_001155227.1.83151 WP_001155227.1.83160 WP_001155227.1.83177 WP_001155227.1.83205 WP_001155227.1.83214 WP_001155227.1.83218 WP_001155227.1.83224 WP_001155227.1.83238 WP_001155227.1.83253 WP_001155227.1.83256 WP_001155227.1.83282 WP_001155227.1.83286 WP_001155227.1.83313 WP_001155227.1.83321 WP_001155227.1.83330 WP_001155227.1.83340 WP_001155227.1.83347 WP_001155227.1.83355 WP_001155227.1.83375 WP_001155227.1.83384 WP_001155227.1.83393 WP_001155227.1.83415 WP_001155227.1.8345 WP_001155227.1.83466 WP_001155227.1.83481 WP_001155227.1.83506 WP_001155227.1.83537 WP_001155227.1.83544 WP_001155227.1.83564 WP_001155227.1.83584 WP_001155227.1.83644 WP_001155227.1.83660 WP_001155227.1.83665 WP_001155227.1.83668 WP_001155227.1.8368 WP_001155227.1.83684 WP_001155227.1.83706 WP_001155227.1.83712 WP_001155227.1.83735 WP_001155227.1.83762 WP_001155227.1.83781 WP_001155227.1.83807 WP_001155227.1.83820 WP_001155227.1.8384 WP_001155227.1.8386 WP_001155227.1.83879 WP_001155227.1.83911 WP_001155227.1.83936 WP_001155227.1.83941 WP_001155227.1.83947 WP_001155227.1.84004 WP_001155227.1.84014 WP_001155227.1.84021 WP_001155227.1.8405 WP_001155227.1.84059 WP_001155227.1.84060 WP_001155227.1.84074 WP_001155227.1.8408 WP_001155227.1.8411 WP_001155227.1.84140 WP_001155227.1.84145 WP_001155227.1.84164 WP_001155227.1.84172 WP_001155227.1.84185 WP_001155227.1.84197 WP_001155227.1.84210 WP_001155227.1.84215 WP_001155227.1.84219 WP_001155227.1.84221 WP_001155227.1.84264 WP_001155227.1.84278 WP_001155227.1.84298 WP_001155227.1.84312 WP_001155227.1.84313 WP_001155227.1.84316 WP_001155227.1.84319 WP_001155227.1.84326 WP_001155227.1.84331 WP_001155227.1.84339 WP_001155227.1.84348 WP_001155227.1.84402 WP_001155227.1.84405 WP_001155227.1.84410 WP_001155227.1.84436 WP_001155227.1.8444 WP_001155227.1.84462 WP_001155227.1.84464 WP_001155227.1.84467 WP_001155227.1.8447 WP_001155227.1.84473 WP_001155227.1.84476 WP_001155227.1.84482 WP_001155227.1.84484 WP_001155227.1.84486 WP_001155227.1.84511 WP_001155227.1.84518 WP_001155227.1.84531 WP_001155227.1.84534 WP_001155227.1.84584 WP_001155227.1.84635 WP_001155227.1.84639 WP_001155227.1.84656 WP_001155227.1.84657 WP_001155227.1.84668 WP_001155227.1.84675 WP_001155227.1.84685 WP_001155227.1.84694 WP_001155227.1.84697 WP_001155227.1.8470 WP_001155227.1.84731 WP_001155227.1.84738 WP_001155227.1.84740 WP_001155227.1.84768 WP_001155227.1.8477 WP_001155227.1.84784 WP_001155227.1.84797 WP_001155227.1.84841 WP_001155227.1.84850 WP_001155227.1.84875 WP_001155227.1.84877 WP_001155227.1.84878 WP_001155227.1.84881 WP_001155227.1.84893 WP_001155227.1.84894 WP_001155227.1.84916 WP_001155227.1.84929 WP_001155227.1.84941 WP_001155227.1.84948 WP_001155227.1.84966 WP_001155227.1.84972 WP_001155227.1.84977 WP_001155227.1.84986 WP_001155227.1.84989 WP_001155227.1.84990 WP_001155227.1.84994 WP_001155227.1.85002 WP_001155227.1.85008 WP_001155227.1.85011 WP_001155227.1.85025 WP_001155227.1.85048 WP_001155227.1.85052 WP_001155227.1.85077 WP_001155227.1.85085 WP_001155227.1.85090 WP_001155227.1.85098 WP_001155227.1.85105 WP_001155227.1.85106 WP_001155227.1.85112 WP_001155227.1.85125 WP_001155227.1.85129 WP_001155227.1.85138 WP_001155227.1.85141 WP_001155227.1.85155 WP_001155227.1.85156 WP_001155227.1.8517 WP_001155227.1.85175 WP_001155227.1.85188 WP_001155227.1.85216 WP_001155227.1.85241 WP_001155227.1.85247 WP_001155227.1.85252 WP_001155227.1.85253 WP_001155227.1.85255 WP_001155227.1.85260 WP_001155227.1.8530 WP_001155227.1.85305 WP_001155227.1.85310 WP_001155227.1.85315 WP_001155227.1.85320 WP_001155227.1.85323 WP_001155227.1.85329 WP_001155227.1.85335 WP_001155227.1.85336 WP_001155227.1.85342 WP_001155227.1.85350 WP_001155227.1.85361 WP_001155227.1.85369 WP_001155227.1.85384 WP_001155227.1.85385 WP_001155227.1.85416 WP_001155227.1.85435 WP_001155227.1.85500 WP_001155227.1.85504 WP_001155227.1.85525 WP_001155227.1.85546 WP_001155227.1.85554 WP_001155227.1.85556 WP_001155227.1.85558 WP_001155227.1.85563 WP_001155227.1.85578 WP_001155227.1.85593 WP_001155227.1.8560 WP_001155227.1.85601 WP_001155227.1.85621 WP_001155227.1.85623 WP_001155227.1.8564 WP_001155227.1.85657 WP_001155227.1.85685 WP_001155227.1.85722 WP_001155227.1.85752 WP_001155227.1.85762 WP_001155227.1.85767 WP_001155227.1.85772 WP_001155227.1.85773 WP_001155227.1.85781 WP_001155227.1.8579 WP_001155227.1.85793 WP_001155227.1.85800 WP_001155227.1.85806 WP_001155227.1.8582 WP_001155227.1.85857 WP_001155227.1.85895 WP_001155227.1.8592 WP_001155227.1.85926 WP_001155227.1.85939 WP_001155227.1.85944 WP_001155227.1.85948 WP_001155227.1.85969 WP_001155227.1.86 WP_001155227.1.86001 WP_001155227.1.86016 WP_001155227.1.8603 WP_001155227.1.86035 WP_001155227.1.86063 WP_001155227.1.8607 WP_001155227.1.86104 WP_001155227.1.86105 WP_001155227.1.86110 WP_001155227.1.86115 WP_001155227.1.86145 WP_001155227.1.86149 WP_001155227.1.86161 WP_001155227.1.86166 WP_001155227.1.86171 WP_001155227.1.86176 WP_001155227.1.86179 WP_001155227.1.86181 WP_001155227.1.86189 WP_001155227.1.8619 WP_001155227.1.86196 WP_001155227.1.8621 WP_001155227.1.86210 WP_001155227.1.86225 WP_001155227.1.86227 WP_001155227.1.86228 WP_001155227.1.86234 WP_001155227.1.86255 WP_001155227.1.86261 WP_001155227.1.86263 WP_001155227.1.86266 WP_001155227.1.86273 WP_001155227.1.86276 WP_001155227.1.86280 WP_001155227.1.86283 WP_001155227.1.86294 WP_001155227.1.86307 WP_001155227.1.86340 WP_001155227.1.8635 WP_001155227.1.86353 WP_001155227.1.86355 WP_001155227.1.86364 WP_001155227.1.86371 WP_001155227.1.86376 WP_001155227.1.86393 WP_001155227.1.86411 WP_001155227.1.86412 WP_001155227.1.86437 WP_001155227.1.86449 WP_001155227.1.86451 WP_001155227.1.86452 WP_001155227.1.86454 WP_001155227.1.86461 WP_001155227.1.86471 WP_001155227.1.86475 WP_001155227.1.86483 WP_001155227.1.86492 WP_001155227.1.86518 WP_001155227.1.8652 WP_001155227.1.8656 WP_001155227.1.86560 WP_001155227.1.86574 WP_001155227.1.86583 WP_001155227.1.86586 WP_001155227.1.86598 WP_001155227.1.86609 WP_001155227.1.86613 WP_001155227.1.86617 WP_001155227.1.86627 WP_001155227.1.86640 WP_001155227.1.86667 WP_001155227.1.86673 WP_001155227.1.86674 WP_001155227.1.86681 WP_001155227.1.86691 WP_001155227.1.86717 WP_001155227.1.86727 WP_001155227.1.86731 WP_001155227.1.86734 WP_001155227.1.86753 WP_001155227.1.86760 WP_001155227.1.86768 WP_001155227.1.86787 WP_001155227.1.86788 WP_001155227.1.8679 WP_001155227.1.86833 WP_001155227.1.86846 WP_001155227.1.86848 WP_001155227.1.8687 WP_001155227.1.86934 WP_001155227.1.86935 WP_001155227.1.86956 WP_001155227.1.86959 WP_001155227.1.86965 WP_001155227.1.86975 WP_001155227.1.86994 WP_001155227.1.86997 WP_001155227.1.87043 WP_001155227.1.8705 WP_001155227.1.87059 WP_001155227.1.87067 WP_001155227.1.87074 WP_001155227.1.87075 WP_001155227.1.87076 WP_001155227.1.87102 WP_001155227.1.87109 WP_001155227.1.8711 WP_001155227.1.87147 WP_001155227.1.87177 WP_001155227.1.87189 WP_001155227.1.87199 WP_001155227.1.87205 WP_001155227.1.87247 WP_001155227.1.87249 WP_001155227.1.87254 WP_001155227.1.8726 WP_001155227.1.87310 WP_001155227.1.87339 WP_001155227.1.87358 WP_001155227.1.87371 WP_001155227.1.87382 WP_001155227.1.87389 WP_001155227.1.87400 WP_001155227.1.87410 WP_001155227.1.87443 WP_001155227.1.87465 WP_001155227.1.87491 WP_001155227.1.87504 WP_001155227.1.87557 WP_001155227.1.87563 WP_001155227.1.87568 WP_001155227.1.87574 WP_001155227.1.87581 WP_001155227.1.87590 WP_001155227.1.87607 WP_001155227.1.87608 WP_001155227.1.87610 WP_001155227.1.87616 WP_001155227.1.87633 WP_001155227.1.87635 WP_001155227.1.87639 WP_001155227.1.87655 WP_001155227.1.87675 WP_001155227.1.87694 WP_001155227.1.87696 WP_001155227.1.8771 WP_001155227.1.87721 WP_001155227.1.87726 WP_001155227.1.87728 WP_001155227.1.87733 WP_001155227.1.87738 WP_001155227.1.87766 WP_001155227.1.8778 WP_001155227.1.87788 WP_001155227.1.87789 WP_001155227.1.87822 WP_001155227.1.87834 WP_001155227.1.87857 WP_001155227.1.87883 WP_001155227.1.87914 WP_001155227.1.87919 WP_001155227.1.8793 WP_001155227.1.87973 WP_001155227.1.87976 WP_001155227.1.87980 WP_001155227.1.87984 WP_001155227.1.87989 WP_001155227.1.87990 WP_001155227.1.880 WP_001155227.1.88017 WP_001155227.1.88020 WP_001155227.1.88066 WP_001155227.1.8807 WP_001155227.1.88082 WP_001155227.1.88088 WP_001155227.1.88110 WP_001155227.1.88119 WP_001155227.1.88147 WP_001155227.1.88149 WP_001155227.1.88155 WP_001155227.1.88189 WP_001155227.1.88197 WP_001155227.1.8822 WP_001155227.1.88234 WP_001155227.1.88238 WP_001155227.1.88252 WP_001155227.1.88260 WP_001155227.1.88263 WP_001155227.1.88285 WP_001155227.1.88301 WP_001155227.1.88304 WP_001155227.1.88335 WP_001155227.1.88336 WP_001155227.1.88352 WP_001155227.1.88376 WP_001155227.1.88379 WP_001155227.1.88384 WP_001155227.1.88427 WP_001155227.1.8843 WP_001155227.1.88434 WP_001155227.1.88438 WP_001155227.1.88462 WP_001155227.1.88467 WP_001155227.1.8848 WP_001155227.1.88499 WP_001155227.1.88505 WP_001155227.1.88524 WP_001155227.1.88527 WP_001155227.1.88528 WP_001155227.1.88535 WP_001155227.1.88539 WP_001155227.1.8854 WP_001155227.1.88549 WP_001155227.1.8855 WP_001155227.1.88557 WP_001155227.1.88562 WP_001155227.1.88577 WP_001155227.1.88598 WP_001155227.1.88603 WP_001155227.1.88607 WP_001155227.1.88631 WP_001155227.1.88646 WP_001155227.1.88667 WP_001155227.1.88678 WP_001155227.1.88685 WP_001155227.1.88686 WP_001155227.1.88709 WP_001155227.1.88710 WP_001155227.1.88711 WP_001155227.1.88717 WP_001155227.1.88720 WP_001155227.1.88729 WP_001155227.1.8873 WP_001155227.1.88732 WP_001155227.1.88735 WP_001155227.1.88752 WP_001155227.1.88757 WP_001155227.1.88759 WP_001155227.1.88767 WP_001155227.1.8879 WP_001155227.1.88793 WP_001155227.1.88803 WP_001155227.1.88807 WP_001155227.1.88826 WP_001155227.1.88830 WP_001155227.1.88834 WP_001155227.1.88864 WP_001155227.1.88880 WP_001155227.1.88883 WP_001155227.1.88891 WP_001155227.1.88941 WP_001155227.1.88950 WP_001155227.1.88953 WP_001155227.1.88961 WP_001155227.1.88997 WP_001155227.1.89018 WP_001155227.1.89043 WP_001155227.1.89050 WP_001155227.1.8906 WP_001155227.1.89067 WP_001155227.1.89069 WP_001155227.1.89078 WP_001155227.1.89090 WP_001155227.1.89099 WP_001155227.1.89111 WP_001155227.1.89150 WP_001155227.1.89163 WP_001155227.1.89165 WP_001155227.1.89183 WP_001155227.1.89197 WP_001155227.1.89200 WP_001155227.1.89203 WP_001155227.1.89214 WP_001155227.1.89217 WP_001155227.1.89255 WP_001155227.1.8928 WP_001155227.1.89285 WP_001155227.1.89305 WP_001155227.1.89312 WP_001155227.1.89322 WP_001155227.1.89334 WP_001155227.1.89335 WP_001155227.1.89351 WP_001155227.1.89379 WP_001155227.1.8938 WP_001155227.1.89385 WP_001155227.1.89396 WP_001155227.1.894 WP_001155227.1.89400 WP_001155227.1.89403 WP_001155227.1.89405 WP_001155227.1.89416 WP_001155227.1.89427 WP_001155227.1.89432 WP_001155227.1.8945 WP_001155227.1.89455 WP_001155227.1.89466 WP_001155227.1.89468 WP_001155227.1.89469 WP_001155227.1.89471 WP_001155227.1.89474 WP_001155227.1.89479 WP_001155227.1.89492 WP_001155227.1.89496 WP_001155227.1.89510 WP_001155227.1.89551 WP_001155227.1.89569 WP_001155227.1.89583 WP_001155227.1.89601 WP_001155227.1.89605 WP_001155227.1.89627 WP_001155227.1.89630 WP_001155227.1.89631 WP_001155227.1.89646 WP_001155227.1.89656 WP_001155227.1.89674 WP_001155227.1.89679 WP_001155227.1.89683 WP_001155227.1.89700 WP_001155227.1.89710 WP_001155227.1.89745 WP_001155227.1.89747 WP_001155227.1.89768 WP_001155227.1.89781 WP_001155227.1.89788 WP_001155227.1.89818 WP_001155227.1.89839 WP_001155227.1.89841 WP_001155227.1.8985 WP_001155227.1.89852 WP_001155227.1.89859 WP_001155227.1.89879 WP_001155227.1.89895 WP_001155227.1.89899 WP_001155227.1.89915 WP_001155227.1.89917 WP_001155227.1.89918 WP_001155227.1.89920 WP_001155227.1.89923 WP_001155227.1.89925 WP_001155227.1.89927 WP_001155227.1.89959 WP_001155227.1.89977 WP_001155227.1.89988 WP_001155227.1.89998 WP_001155227.1.90017 WP_001155227.1.90022 WP_001155227.1.90050 WP_001155227.1.90063 WP_001155227.1.90065 WP_001155227.1.90078 WP_001155227.1.9009 WP_001155227.1.90098 WP_001155227.1.9010 WP_001155227.1.90115 WP_001155227.1.90128 WP_001155227.1.90139 WP_001155227.1.90146 WP_001155227.1.90156 WP_001155227.1.90168 WP_001155227.1.90171 WP_001155227.1.90182 WP_001155227.1.902 WP_001155227.1.90205 WP_001155227.1.90219 WP_001155227.1.90249 WP_001155227.1.90251 WP_001155227.1.90256 WP_001155227.1.90257 WP_001155227.1.90266 WP_001155227.1.90270 WP_001155227.1.90314 WP_001155227.1.90315 WP_001155227.1.90332 WP_001155227.1.90342 WP_001155227.1.90346 WP_001155227.1.90349 WP_001155227.1.90357 WP_001155227.1.90358 WP_001155227.1.9036 WP_001155227.1.9037 WP_001155227.1.90389 WP_001155227.1.90405 WP_001155227.1.90435 WP_001155227.1.90436 WP_001155227.1.90441 WP_001155227.1.90449 WP_001155227.1.90467 WP_001155227.1.90511 WP_001155227.1.90520 WP_001155227.1.90525 WP_001155227.1.90536 WP_001155227.1.90547 WP_001155227.1.90576 WP_001155227.1.9059 WP_001155227.1.90591 WP_001155227.1.90602 WP_001155227.1.9061 WP_001155227.1.90626 WP_001155227.1.90690 WP_001155227.1.90703 WP_001155227.1.90706 WP_001155227.1.90758 WP_001155227.1.90775 WP_001155227.1.90799 WP_001155227.1.9081 WP_001155227.1.90813 WP_001155227.1.90822 WP_001155227.1.90828 WP_001155227.1.90834 WP_001155227.1.90837 WP_001155227.1.90839 WP_001155227.1.9084 WP_001155227.1.90842 WP_001155227.1.90844 WP_001155227.1.90848 WP_001155227.1.90864 WP_001155227.1.90865 WP_001155227.1.9087 WP_001155227.1.90873 WP_001155227.1.90890 WP_001155227.1.909 WP_001155227.1.90905 WP_001155227.1.90924 WP_001155227.1.90951 WP_001155227.1.90960 WP_001155227.1.90967 WP_001155227.1.90979 WP_001155227.1.9098 WP_001155227.1.90986 WP_001155227.1.90988 WP_001155227.1.90996 WP_001155227.1.90997 WP_001155227.1.91 WP_001155227.1.91007 WP_001155227.1.91010 WP_001155227.1.91018 WP_001155227.1.9104 WP_001155227.1.91071 WP_001155227.1.91072 WP_001155227.1.91088 WP_001155227.1.91094 WP_001155227.1.91113 WP_001155227.1.91115 WP_001155227.1.91117 WP_001155227.1.91121 WP_001155227.1.91138 WP_001155227.1.91143 WP_001155227.1.91153 WP_001155227.1.91170 WP_001155227.1.9118 WP_001155227.1.91182 WP_001155227.1.9119 WP_001155227.1.91213 WP_001155227.1.91220 WP_001155227.1.91266 WP_001155227.1.91268 WP_001155227.1.91277 WP_001155227.1.91288 WP_001155227.1.91290 WP_001155227.1.91340 WP_001155227.1.91341 WP_001155227.1.91354 WP_001155227.1.91356 WP_001155227.1.91361 WP_001155227.1.91377 WP_001155227.1.91384 WP_001155227.1.91397 WP_001155227.1.91414 WP_001155227.1.91425 WP_001155227.1.91445 WP_001155227.1.91462 WP_001155227.1.91482 WP_001155227.1.91485 WP_001155227.1.91494 WP_001155227.1.915 WP_001155227.1.91511 WP_001155227.1.91515 WP_001155227.1.91516 WP_001155227.1.91526 WP_001155227.1.91543 WP_001155227.1.91548 WP_001155227.1.91549 WP_001155227.1.91551 WP_001155227.1.9156 WP_001155227.1.91565 WP_001155227.1.91566 WP_001155227.1.9157 WP_001155227.1.91594 WP_001155227.1.91596 WP_001155227.1.9160 WP_001155227.1.91626 WP_001155227.1.91630 WP_001155227.1.91640 WP_001155227.1.91643 WP_001155227.1.91644 WP_001155227.1.91651 WP_001155227.1.91666 WP_001155227.1.91672 WP_001155227.1.9168 WP_001155227.1.91685 WP_001155227.1.9169 WP_001155227.1.91701 WP_001155227.1.9171 WP_001155227.1.91739 WP_001155227.1.91756 WP_001155227.1.91777 WP_001155227.1.91779 WP_001155227.1.91782 WP_001155227.1.91787 WP_001155227.1.91793 WP_001155227.1.91801 WP_001155227.1.91814 WP_001155227.1.91843 WP_001155227.1.9185 WP_001155227.1.91850 WP_001155227.1.91863 WP_001155227.1.91871 WP_001155227.1.91879 WP_001155227.1.91887 WP_001155227.1.91893 WP_001155227.1.91894 WP_001155227.1.91951 WP_001155227.1.91954 WP_001155227.1.91959 WP_001155227.1.91965 WP_001155227.1.91971 WP_001155227.1.9199 WP_001155227.1.91994 WP_001155227.1.92005 WP_001155227.1.92014 WP_001155227.1.92019 WP_001155227.1.92025 WP_001155227.1.92029 WP_001155227.1.92031 WP_001155227.1.92048 WP_001155227.1.92053 WP_001155227.1.92058 WP_001155227.1.9209 WP_001155227.1.92096 WP_001155227.1.921 WP_001155227.1.92102 WP_001155227.1.92114 WP_001155227.1.92123 WP_001155227.1.9215 WP_001155227.1.92161 WP_001155227.1.92163 WP_001155227.1.92180 WP_001155227.1.92195 WP_001155227.1.92201 WP_001155227.1.92215 WP_001155227.1.92224 WP_001155227.1.92276 WP_001155227.1.92291 WP_001155227.1.92295 WP_001155227.1.92304 WP_001155227.1.92305 WP_001155227.1.92311 WP_001155227.1.92323 WP_001155227.1.92361 WP_001155227.1.92384 WP_001155227.1.924 WP_001155227.1.92403 WP_001155227.1.92434 WP_001155227.1.92451 WP_001155227.1.92462 WP_001155227.1.92473 WP_001155227.1.92495 WP_001155227.1.92496 WP_001155227.1.92506 WP_001155227.1.92532 WP_001155227.1.92535 WP_001155227.1.9255 WP_001155227.1.92568 WP_001155227.1.92571 WP_001155227.1.92577 WP_001155227.1.92614 WP_001155227.1.92615 WP_001155227.1.92634 WP_001155227.1.92638 WP_001155227.1.9264 WP_001155227.1.92648 WP_001155227.1.9266 WP_001155227.1.92668 WP_001155227.1.92693 WP_001155227.1.92708 WP_001155227.1.92719 WP_001155227.1.92742 WP_001155227.1.92750 WP_001155227.1.92767 WP_001155227.1.92780 WP_001155227.1.92781 WP_001155227.1.92792 WP_001155227.1.92793 WP_001155227.1.92796 WP_001155227.1.92819 WP_001155227.1.92845 WP_001155227.1.92865 WP_001155227.1.92882 WP_001155227.1.92886 WP_001155227.1.92932 WP_001155227.1.92943 WP_001155227.1.92953 WP_001155227.1.92989 WP_001155227.1.92991 WP_001155227.1.93005 WP_001155227.1.93016 WP_001155227.1.93017 WP_001155227.1.93019 WP_001155227.1.93023 WP_001155227.1.93027 WP_001155227.1.93033 WP_001155227.1.93037 WP_001155227.1.93048 WP_001155227.1.93052 WP_001155227.1.93054 WP_001155227.1.93069 WP_001155227.1.93072 WP_001155227.1.93085 WP_001155227.1.93100 WP_001155227.1.93112 WP_001155227.1.93133 WP_001155227.1.93138 WP_001155227.1.93139 WP_001155227.1.93150 WP_001155227.1.93167 WP_001155227.1.93175 WP_001155227.1.93185 WP_001155227.1.93233 WP_001155227.1.93252 WP_001155227.1.93267 WP_001155227.1.9327 WP_001155227.1.93276 WP_001155227.1.93291 WP_001155227.1.93309 WP_001155227.1.9331 WP_001155227.1.93312 WP_001155227.1.93326 WP_001155227.1.93338 WP_001155227.1.93379 WP_001155227.1.93388 WP_001155227.1.934 WP_001155227.1.93427 WP_001155227.1.93428 WP_001155227.1.93431 WP_001155227.1.93453 WP_001155227.1.93461 WP_001155227.1.93463 WP_001155227.1.93468 WP_001155227.1.93509 WP_001155227.1.93531 WP_001155227.1.93533 WP_001155227.1.93552 WP_001155227.1.9356 WP_001155227.1.93569 WP_001155227.1.93581 WP_001155227.1.93601 WP_001155227.1.93605 WP_001155227.1.93621 WP_001155227.1.93626 WP_001155227.1.93629 WP_001155227.1.93630 WP_001155227.1.93634 WP_001155227.1.93637 WP_001155227.1.93639 WP_001155227.1.93652 WP_001155227.1.93665 WP_001155227.1.93670 WP_001155227.1.93673 WP_001155227.1.93679 WP_001155227.1.93694 WP_001155227.1.93695 WP_001155227.1.93704 WP_001155227.1.93716 WP_001155227.1.93733 WP_001155227.1.93737 WP_001155227.1.93742 WP_001155227.1.93743 WP_001155227.1.93745 WP_001155227.1.93755 WP_001155227.1.93765 WP_001155227.1.93768 WP_001155227.1.938 WP_001155227.1.93800 WP_001155227.1.93821 WP_001155227.1.93870 WP_001155227.1.93873 WP_001155227.1.93877 WP_001155227.1.939 WP_001155227.1.93900 WP_001155227.1.93911 WP_001155227.1.93918 WP_001155227.1.93921 WP_001155227.1.93922 WP_001155227.1.93939 WP_001155227.1.93951 WP_001155227.1.93952 WP_001155227.1.93971 WP_001155227.1.94008 WP_001155227.1.94025 WP_001155227.1.94028 WP_001155227.1.94035 WP_001155227.1.94040 WP_001155227.1.94057 WP_001155227.1.94069 WP_001155227.1.94111 WP_001155227.1.94156 WP_001155227.1.9416 WP_001155227.1.94176 WP_001155227.1.94187 WP_001155227.1.94188 WP_001155227.1.94190 WP_001155227.1.9420 WP_001155227.1.94213 WP_001155227.1.94232 WP_001155227.1.9426 WP_001155227.1.94271 WP_001155227.1.94282 WP_001155227.1.94298 WP_001155227.1.94302 WP_001155227.1.94317 WP_001155227.1.94343 WP_001155227.1.94351 WP_001155227.1.94353 WP_001155227.1.94367 WP_001155227.1.94388 WP_001155227.1.94404 WP_001155227.1.94417 WP_001155227.1.94429 WP_001155227.1.94430 WP_001155227.1.94436 WP_001155227.1.94438 WP_001155227.1.94445 WP_001155227.1.94446 WP_001155227.1.94468 WP_001155227.1.9447 WP_001155227.1.94475 WP_001155227.1.94497 WP_001155227.1.94507 WP_001155227.1.94516 WP_001155227.1.94523 WP_001155227.1.94542 WP_001155227.1.94544 WP_001155227.1.94548 WP_001155227.1.9457 WP_001155227.1.94578 WP_001155227.1.94580 WP_001155227.1.94589 WP_001155227.1.94619 WP_001155227.1.94626 WP_001155227.1.94646 WP_001155227.1.94653 WP_001155227.1.94676 WP_001155227.1.94686 WP_001155227.1.94690 WP_001155227.1.94692 WP_001155227.1.94695 WP_001155227.1.94704 WP_001155227.1.94727 WP_001155227.1.94738 WP_001155227.1.94739 WP_001155227.1.9474 WP_001155227.1.94753 WP_001155227.1.94754 WP_001155227.1.94763 WP_001155227.1.94764 WP_001155227.1.94787 WP_001155227.1.94790 WP_001155227.1.948 WP_001155227.1.94801 WP_001155227.1.94806 WP_001155227.1.94808 WP_001155227.1.94822 WP_001155227.1.94823 WP_001155227.1.94836 WP_001155227.1.94841 WP_001155227.1.94847 WP_001155227.1.94869 WP_001155227.1.94880 WP_001155227.1.94889 WP_001155227.1.9489 WP_001155227.1.94892 WP_001155227.1.94898 WP_001155227.1.949 WP_001155227.1.94903 WP_001155227.1.94907 WP_001155227.1.9491 WP_001155227.1.94927 WP_001155227.1.94934 WP_001155227.1.94935 WP_001155227.1.94938 WP_001155227.1.94949 WP_001155227.1.94955 WP_001155227.1.94963 WP_001155227.1.94991 WP_001155227.1.94993 WP_001155227.1.94997 WP_001155227.1.95005 WP_001155227.1.95011 WP_001155227.1.95022 WP_001155227.1.95028 WP_001155227.1.95035 WP_001155227.1.95036 WP_001155227.1.95037 WP_001155227.1.95062 WP_001155227.1.95080 WP_001155227.1.95084 WP_001155227.1.95105 WP_001155227.1.95129 WP_001155227.1.9513 WP_001155227.1.95161 WP_001155227.1.95198 WP_001155227.1.95233 WP_001155227.1.95243 WP_001155227.1.95244 WP_001155227.1.95253 WP_001155227.1.95254 WP_001155227.1.95275 WP_001155227.1.95290 WP_001155227.1.95310 WP_001155227.1.95329 WP_001155227.1.95332 WP_001155227.1.95364 WP_001155227.1.95366 WP_001155227.1.95368 WP_001155227.1.95378 WP_001155227.1.95381 WP_001155227.1.95390 WP_001155227.1.95395 WP_001155227.1.95398 WP_001155227.1.95400 WP_001155227.1.95403 WP_001155227.1.95424 WP_001155227.1.95428 WP_001155227.1.95431 WP_001155227.1.95438 WP_001155227.1.95449 WP_001155227.1.95490 WP_001155227.1.95518 WP_001155227.1.95521 WP_001155227.1.95563 WP_001155227.1.9559 WP_001155227.1.95595 WP_001155227.1.95596 WP_001155227.1.95604 WP_001155227.1.95611 WP_001155227.1.95628 WP_001155227.1.95634 WP_001155227.1.95648 WP_001155227.1.95655 WP_001155227.1.9566 WP_001155227.1.95666 WP_001155227.1.95712 WP_001155227.1.95756 WP_001155227.1.95759 WP_001155227.1.95771 WP_001155227.1.95783 WP_001155227.1.95784 WP_001155227.1.95800 WP_001155227.1.95801 WP_001155227.1.95821 WP_001155227.1.95824 WP_001155227.1.95827 WP_001155227.1.95834 WP_001155227.1.95835 WP_001155227.1.95846 WP_001155227.1.95849 WP_001155227.1.95858 WP_001155227.1.95861 WP_001155227.1.95865 WP_001155227.1.95869 WP_001155227.1.95916 WP_001155227.1.95919 WP_001155227.1.95929 WP_001155227.1.95931 WP_001155227.1.95932 WP_001155227.1.95951 WP_001155227.1.960 WP_001155227.1.96015 WP_001155227.1.96032 WP_001155227.1.96053 WP_001155227.1.96059 WP_001155227.1.96066 WP_001155227.1.96086 WP_001155227.1.96097 WP_001155227.1.96110 WP_001155227.1.96114 WP_001155227.1.96128 WP_001155227.1.96143 WP_001155227.1.96145 WP_001155227.1.9616 WP_001155227.1.96177 WP_001155227.1.96215 WP_001155227.1.96222 WP_001155227.1.96223 WP_001155227.1.96229 WP_001155227.1.96247 WP_001155227.1.96253 WP_001155227.1.96263 WP_001155227.1.96278 WP_001155227.1.96279 WP_001155227.1.96281 WP_001155227.1.96290 WP_001155227.1.96293 WP_001155227.1.96299 WP_001155227.1.96339 WP_001155227.1.96341 WP_001155227.1.96378 WP_001155227.1.96392 WP_001155227.1.96394 WP_001155227.1.9641 WP_001155227.1.96417 WP_001155227.1.96420 WP_001155227.1.96425 WP_001155227.1.96450 WP_001155227.1.96457 WP_001155227.1.96478 WP_001155227.1.96479 WP_001155227.1.96480 WP_001155227.1.96484 WP_001155227.1.9649 WP_001155227.1.96494 WP_001155227.1.965 WP_001155227.1.96519 WP_001155227.1.96541 WP_001155227.1.96558 WP_001155227.1.96562 WP_001155227.1.9657 WP_001155227.1.96585 WP_001155227.1.96608 WP_001155227.1.96609 WP_001155227.1.9661 WP_001155227.1.96617 WP_001155227.1.96633 WP_001155227.1.96650 WP_001155227.1.96659 WP_001155227.1.96676 WP_001155227.1.9668 WP_001155227.1.96680 WP_001155227.1.96683 WP_001155227.1.96695 WP_001155227.1.9671 WP_001155227.1.96725 WP_001155227.1.96743 WP_001155227.1.96753 WP_001155227.1.96759 WP_001155227.1.96762 WP_001155227.1.96769 WP_001155227.1.96779 WP_001155227.1.96796 WP_001155227.1.96797 WP_001155227.1.96817 WP_001155227.1.9682 WP_001155227.1.96820 WP_001155227.1.96850 WP_001155227.1.96864 WP_001155227.1.96894 WP_001155227.1.9690 WP_001155227.1.96907 WP_001155227.1.9691 WP_001155227.1.96924 WP_001155227.1.96932 WP_001155227.1.96936 WP_001155227.1.96944 WP_001155227.1.96971 WP_001155227.1.96984 WP_001155227.1.96989 WP_001155227.1.97011 WP_001155227.1.97027 WP_001155227.1.97049 WP_001155227.1.97059 WP_001155227.1.9708 WP_001155227.1.97119 WP_001155227.1.97123 WP_001155227.1.97147 WP_001155227.1.97160 WP_001155227.1.97170 WP_001155227.1.97193 WP_001155227.1.97195 WP_001155227.1.97200 WP_001155227.1.97226 WP_001155227.1.9723 WP_001155227.1.97231 WP_001155227.1.97238 WP_001155227.1.97247 WP_001155227.1.97248 WP_001155227.1.97269 WP_001155227.1.97279 WP_001155227.1.97282 WP_001155227.1.9729 WP_001155227.1.97292 WP_001155227.1.97344 WP_001155227.1.97351 WP_001155227.1.97356 WP_001155227.1.97360 WP_001155227.1.97361 WP_001155227.1.97379 WP_001155227.1.97387 WP_001155227.1.9740 WP_001155227.1.97402 WP_001155227.1.97418 WP_001155227.1.97421 WP_001155227.1.97434 WP_001155227.1.97437 WP_001155227.1.97439 WP_001155227.1.97459 WP_001155227.1.97464 WP_001155227.1.9747 WP_001155227.1.97490 WP_001155227.1.97502 WP_001155227.1.97513 WP_001155227.1.97525 WP_001155227.1.97527 WP_001155227.1.97538 WP_001155227.1.97544 WP_001155227.1.97549 WP_001155227.1.97560 WP_001155227.1.97571 WP_001155227.1.97619 WP_001155227.1.97632 WP_001155227.1.97654 WP_001155227.1.97667 WP_001155227.1.97675 WP_001155227.1.97677 WP_001155227.1.97685 WP_001155227.1.9770 WP_001155227.1.97705 WP_001155227.1.97711 WP_001155227.1.97770 WP_001155227.1.97775 WP_001155227.1.97778 WP_001155227.1.97779 WP_001155227.1.97789 WP_001155227.1.97798 WP_001155227.1.978 WP_001155227.1.97802 WP_001155227.1.97815 WP_001155227.1.97822 WP_001155227.1.97823 WP_001155227.1.97825 WP_001155227.1.97871 WP_001155227.1.97895 WP_001155227.1.97919 WP_001155227.1.97930 WP_001155227.1.97932 WP_001155227.1.97937 WP_001155227.1.97962 WP_001155227.1.97982 WP_001155227.1.97996 WP_001155227.1.98000 WP_001155227.1.98005 WP_001155227.1.98012 WP_001155227.1.98026 WP_001155227.1.9803 WP_001155227.1.98046 WP_001155227.1.98082 WP_001155227.1.98083 WP_001155227.1.981 WP_001155227.1.98102 WP_001155227.1.98115 WP_001155227.1.98129 WP_001155227.1.98139 WP_001155227.1.98155 WP_001155227.1.9816 WP_001155227.1.98167 WP_001155227.1.9817 WP_001155227.1.98176 WP_001155227.1.98187 WP_001155227.1.98202 WP_001155227.1.98205 WP_001155227.1.98220 WP_001155227.1.98232 WP_001155227.1.98235 WP_001155227.1.98239 WP_001155227.1.98241 WP_001155227.1.98244 WP_001155227.1.98251 WP_001155227.1.98279 WP_001155227.1.98284 WP_001155227.1.98292 WP_001155227.1.98294 WP_001155227.1.98301 WP_001155227.1.98312 WP_001155227.1.98323 WP_001155227.1.98355 WP_001155227.1.98357 WP_001155227.1.98384 WP_001155227.1.98400 WP_001155227.1.98404 WP_001155227.1.98424 WP_001155227.1.98429 WP_001155227.1.9844 WP_001155227.1.98442 WP_001155227.1.98451 WP_001155227.1.98466 WP_001155227.1.98477 WP_001155227.1.98480 WP_001155227.1.98484 WP_001155227.1.98498 WP_001155227.1.98543 WP_001155227.1.98549 WP_001155227.1.98569 WP_001155227.1.98578 WP_001155227.1.9858 WP_001155227.1.98614 WP_001155227.1.98626 WP_001155227.1.98633 WP_001155227.1.9864 WP_001155227.1.98641 WP_001155227.1.98654 WP_001155227.1.98665 WP_001155227.1.98668 WP_001155227.1.98683 WP_001155227.1.98702 WP_001155227.1.98727 WP_001155227.1.98757 WP_001155227.1.98775 WP_001155227.1.98776 WP_001155227.1.98784 WP_001155227.1.98795 WP_001155227.1.9883 WP_001155227.1.98849 WP_001155227.1.98853 WP_001155227.1.98875 WP_001155227.1.98886 WP_001155227.1.98908 WP_001155227.1.98920 WP_001155227.1.98976 WP_001155227.1.98988 WP_001155227.1.99006 WP_001155227.1.99029 WP_001155227.1.99046 WP_001155227.1.99053 WP_001155227.1.99060 WP_001155227.1.9907 WP_001155227.1.99101 WP_001155227.1.99110 WP_001155227.1.99119 WP_001155227.1.99168 WP_001155227.1.99182 WP_001155227.1.99209 WP_001155227.1.99234 WP_001155227.1.99246 WP_001155227.1.99265 WP_001155227.1.99289 WP_001155227.1.99292 WP_001155227.1.99295 WP_001155227.1.9930 WP_001155227.1.99302 WP_001155227.1.99304 WP_001155227.1.99306 WP_001155227.1.99307 WP_001155227.1.99310 WP_001155227.1.99334 WP_001155227.1.99345 WP_001155227.1.99349 WP_001155227.1.9935 WP_001155227.1.99361 WP_001155227.1.99366 WP_001155227.1.99392 WP_001155227.1.9940 WP_001155227.1.99400 WP_001155227.1.99401 WP_001155227.1.99427 WP_001155227.1.99446 WP_001155227.1.99453 WP_001155227.1.99458 WP_001155227.1.99471 WP_001155227.1.99472 WP_001155227.1.99475 WP_001155227.1.99486 WP_001155227.1.99487 WP_001155227.1.99498 WP_001155227.1.9950 WP_001155227.1.99500 WP_001155227.1.99501 WP_001155227.1.99511 WP_001155227.1.99534 WP_001155227.1.99549 WP_001155227.1.99562 WP_001155227.1.99571 WP_001155227.1.99592 WP_001155227.1.99602 WP_001155227.1.99603 WP_001155227.1.99619 WP_001155227.1.99632 WP_001155227.1.99641 WP_001155227.1.99666 WP_001155227.1.99692 WP_001155227.1.99694 WP_001155227.1.99698 WP_001155227.1.99734 WP_001155227.1.99771 WP_001155227.1.99774 WP_001155227.1.99782 WP_001155227.1.99791 WP_001155227.1.99804 WP_001155227.1.99827 WP_001155227.1.99856 WP_001155227.1.99869 WP_001155227.1.99874 WP_001155227.1.99891 WP_001155227.1.99892 WP_001155227.1.99912 WP_001155227.1.99929 WP_001155227.1.99986 YP_002406195.1.10275 YP_002410920.1.14968 YP_006118516.1.29421 YP_006780832.1.12065 YP_401884.1.10455 gi|407483683|ref|YP_006780832.1| gi|218547601|ref|YP_002381392.1| 1tjl_A 1tjl_B 1tjl_C 1tjl_D 1tjl_E 1tjl_F 1tjl_G 1tjl_H 1tjl_I 1tjl_J 5vsw_M 5w1t_M 5w1t_N gi|82542745|ref|YP_406692.1| gi|386612309|ref|YP_006131975.1| gi|15799829|ref|NP_285841.1| gi|556550373|ref|YP_008720230.1| gi|260842379|ref|YP_003220157.1| gi|387615494|ref|YP_006118516.1| gi|387880705|ref|YP_006311007.1| gi|110804200|ref|YP_687720.1| gi|170021501|ref|YP_001726455.1| gi|161486322|ref|NP_752128.2| gi|157159611|ref|YP_001456929.1| gi|378714515|ref|YP_005279408.1| gi|110640366|ref|YP_668094.1| gi|387619913|ref|YP_006127540.1| gi|386607237|ref|YP_006113537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]