SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1trbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1trbA
Domain Number 1 Region: 3-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.15e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1trbA   PDB: 1trb
Sequence length 320
Comment (A:)
Sequence
gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
lpseeafkgrgvsacatsdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
tgcmaaldaeryldgladak
Download sequence
Identical sequences 1trb_A 1trbA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]