SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1tuaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tuaA
Domain Number 1 Region: 88-179
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.7e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000392
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000283
Family Eukaryotic type KH-domain (KH-domain type I) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tuaA   PDB: 1tua
Sequence length 191
Comment (A:)
Sequence
amkpriyvkvkperlgavigprgevkaeimrrtgtvitvdtensmvivepeaegippvnl
mkaaevvkaislgfppekafrlleedqilvvvdlkqvvgdsqnhlkrikgriigeggrar
rtieemtdtyinvgeyevaiigdyeramaakqaiemlaegrmhstvyrhlerimreikrr
erlkmwareel
Download sequence
Identical sequences 1tuaA 1tua_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]