SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1tytA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tytA
Domain Number 1 Region: 1-103,231-352
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.4e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000799
Further Details:      
 
Domain Number 2 Region: 362-483
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.51e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000327
Further Details:      
 
Domain Number 3 Region: 2-64,104-229
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.69e-17
Family UDP-galactopyranose mutase, N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tytA   PDB: 1tyt
Sequence length 487
Comment (A:)
Sequence
msraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpk
klmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadtegl
tfhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsne
afyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlte
qlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkag
vevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdht
kvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnha
dgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqk
gkrveki
Download sequence
Identical sequences 1tytA 1tyt_A 1tyt_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]