SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1tzlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tzlA
Domain Number 1 Region: 354-551
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.59e-70
Family GMC oxidoreductases 0.00000000177
Further Details:      
 
Domain Number 2 Region: 42-358,547-611
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-46
Family FAD-linked reductases, N-terminal domain 0.0000000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tzlA   PDB: 1tzl
Sequence length 622
Comment (A:)
Sequence
stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
aiksceyikqnftpspftseaq
Download sequence
Identical sequences 1tzl_A 1tzl_B 1tzl_C 1tzl_D 1tzl_E 1tzl_F 1tzl_G 1tzl_H 1tzlA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]