SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ub3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ub3A
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily Aldolase 3.57e-110
Family Class I aldolase 0.000000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ub3A   PDB: 1ub3   SUPERFAMILY: 1ub3A
Sequence length 220
Comment (A:)
Sequence
MDLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTV
VGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAV
LKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVK
AAGGIRDRETALRMLKAGASRLGTSSGVALVAGEGGTLGY
Download sequence
Identical sequences Q5SJ28
1ub3A gi|55981155|ref|YP_144452.1| 300852.TTHA1186 ttk003000501.1 ttk003000501.2 1j2w_A 1j2w_B 1j2w_C 1j2w_D 1ub3_A 1ub3_B 1ub3_C 1ub3_D cath|current|1j2wA00/1-212 cath|current|1j2wB00/1-211 cath|current|1j2wC00/1-212 cath|current|1j2wD00/2-211 cath|current|1ub3A00/2-212 cath|current|1ub3B00/1-211 cath|current|1ub3C00/2-211 cath|current|1ub3D00/2-212 YP_144452.1.19876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]