SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ugcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ugcA
Domain Number 1 Region: 3-257
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.2e-144
Family Carbonic anhydrase 0.0000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ugcA   PDB: 1ugc   SUPERFAMILY: 1ugcA
Sequence length 258
Comment (A:)
Sequence
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghhfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk
Download sequence
Identical sequences 1ugc_A 000044545|e1ugcA1|62.1.1.1|A:1-258 cath|current|1ugcA00/3-261 d1ugca_ 1ugcA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]