SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1urtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1urtA
Domain Number 1 Region: 4-240
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.47e-129
Family Carbonic anhydrase 0.0000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1urtA   PDB: 1urt   SUPERFAMILY: 1urtA
Sequence length 248
Comment (A:)
Sequence
saegtrqspiniqwkdsvydpqlaplrvsydaascrylwntghafqvefddscedsgisg
gplgnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgengl
avigvflklgahhqalqklvdvlpevrhkdtqvamgdfdpsclmpacrdywtypgslttp
plaesvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr
ldrtkmrs
Download sequence
Identical sequences 1urtA cath|current|1urtA00/25-261 1urt_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]