SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1v43A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v43A
Domain Number 1 Region: 12-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.25e-91
Family ABC transporter ATPase domain-like 0.0000000263
Further Details:      
 
Domain Number 2 Region: 245-371
Classification Level Classification E-value
Superfamily MOP-like 8.18e-27
Family ABC-transporter additional domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v43A   PDB: 1v43
Sequence length 372
Comment (A:)
Sequence
gnnievikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagl
eeptegriyfgdrdvtylppkdrnismvfqsyavwphmtvyeniafplkikkfpkdeidk
rvrwaaellqieellnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvam
raeikklqqklkvttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvat
figapemnilevsvgdgylegrgfrielpqdlmdllkdyvgktvlfgirpehmtvegvse
lahmkrtarligkvdfvealgtdtilhvkfgdelvkvklpghipiepgrevkvimdldmi
hvfdkdtekaiv
Download sequence
Identical sequences 1v43A 1v43_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]