SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1v59A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v59A
Domain Number 1 Region: 358-467
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.42e-76
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000668
Further Details:      
 
Domain Number 2 Region: 3-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.15e-60
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000648
Further Details:      
 
Domain Number 3 Region: 6-43
Classification Level Classification E-value
Superfamily PDB 0.00000188
Family PDB 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v59A   PDB: 1v59
Sequence length 478
Comment (A:)
Sequence
tinkshdvviigggpagyvaaikaaqlgfntacvekrgklggtclnvgcipskallnnsh
lfhqmhteaqkrgidvngdikinvanfqkakddavkqltggiellfkknkvtyykgngsf
edetkirvtpvdglegtvkedhildvkniivatgsevtpfpgieideekivsstgalslk
eipkrltiigggiiglemgsvysrlgskvtvvefqpqigasmdgevakatqkflkkqgld
fklstkvisakrnddknvveivvedtktnkqenleaevllvavgrrpyiaglgaekigle
vdkrgrlviddqfnskfphikvvgdvtfgpmlahkaeeegiaavemlktghghvnynnip
svmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilidskteri
lgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydkaihc
Download sequence
Identical sequences 1v59A 1jeh_A 1jeh_B 1v59_A 1v59_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]