SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1vdcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vdcA
Domain Number 1 Region: 6-322
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vdcA   PDB: 1vdc
Sequence length 333
Comment (A:)
Sequence
mnglethntrlcivgsgpaahtaaiyaaraelkpllfegwmandiapggqlttttdvenf
pgfpegilgveltdkfrkqserfgttiftetvtkvdfsskpfklftdskailadavilai
gavakrlsfvgsgevlggfwnrgisacavcdgaapifrnkplavigggdsameeanfltk
ygskvyiihrrdafraskimqqralsnpkidviwnssvveaygdgerdvlgglkvknvvt
gdvsdlkvsglffaighepatkfldggveldsdgyvvtkpgttqtsvpgvfaagdvqdkk
yrqaitaagtgcmaaldaehylqeigsqegksd
Download sequence
Identical sequences 1vdc_A 1vdcA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]